Von Hippel Lindau (VHL) (NM_000551) Human Tagged ORF Clone
CAT#: RC216151
VHL (Myc-DDK-tagged)-Human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1
ORF Plasmid: tGFP
"NM_000551" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 4 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HRCA1; pVHL; RCA1; VHL1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC216151 representing NM_000551
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCCGGAGGGCGGAGAACTGGGACGAGGCCGAGGTAGGCGCGGAGGAGGCAGGCGTCGAAGAGTACG GCCCTGAAGAAGACGGCGGGGAGGAGTCGGGCGCCGAGGAGTCCGGCCCGGAAGAGTCCGGCCCGGAGGA ACTGGGCGCCGAGGAGGAGATGGAGGCCGGGCGGCCGCGGCCCGTGCTGCGCTCGGTGAACTCGCGCGAG CCCTCCCAGGTCATCTTCTGCAATCGCAGTCCGCGCGTCGTGCTGCCCGTATGGCTCAACTTCGACGGCG AGCCGCAGCCCTACCCAACGCTGCCGCCTGGCACGGGCCGCCGCATCCACAGCTACCGAGGTCACCTTTG GCTCTTCAGAGATGCAGGGACACACGATGGGCTTCTGGTTAACCAAACTGAATTATTTGTGCCATCTCTC AATGTTGACGGACAGCCTATTTTTGCCAATATCACACTGCCAGTGTATACTCTGAAAGAGCGATGCCTCC AGGTTGTCCGGAGCCTAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGA TCTGGAAGACCACCCAAATGTGCAGAAAGACCTGGAGCGGCTGACACAGGAGCGCATTGCACATCAACGG ATGGGAGAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC216151 representing NM_000551
Red=Cloning site Green=Tags(s) MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSRE PSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSL NVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQR MGD myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000551 |
ORF Size | 639 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000551.4 |
RefSeq Size | 2968 bp |
RefSeq ORF | 642 bp |
Locus ID | 7428 |
UniProt ID | P40337 |
Domains | VHL |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis |
MW | 24 kDa |
Gene Summary | Von Hippel-Lindau syndrome (VHL) is a dominantly inherited familial cancer syndrome predisposing to a variety of malignant and benign tumors. A germline mutation of this gene is the basis of familial inheritance of VHL syndrome. The protein encoded by this gene is a component of the protein complex that includes elongin B, elongin C, and cullin-2, and possesses ubiquitin ligase E3 activity. This protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. RNA polymerase II subunit POLR2G/RPB7 is also reported to be a target of this protein. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Citations (4)
The use of this cDNA Clones has been cited in the following citations: |
---|
Suppression of Breast Cancer Progression by FBXL16 Via Oxygen-Independent Regulation of HIF1α Stability
,Kim, Y;Zhao, Y;Kyung, M;Yi, J;Kim, M;Lee, S;,
SSRN Electronic Journal
[Von Hippel Lindau]
|
Interactions between TGF-β type I receptor and hypoxia-inducible factor-α mediates a synergistic crosstalk leading to poor prognosis for patients with clear cell renal cell carcinoma
,Mallikarjuna, P;Raviprakash, TS;Aripaka, K;Ljungberg, B;Landström, M;,
Cell Cycle
,PubMed ID 31339433
[Von Hippel Lindau]
|
VHL status regulates transforming growth factor-β signaling pathways in renal cell carcinoma
,Mallikarjuna, P;Sitaram, RT;Landström, M;Ljungberg, B;,
Oncotarget
,PubMed ID 29662646
[Von Hippel Lindau]
|
Novel homozygous VHL mutation in exon 2 is associated with congenital polycythemia but not with cancer
,Lucie Lanikova, Felipe Lorenzo, Chunzhang Yang, Hari Vankayalapati, Richard Drachtman, Vladimir Divoky, and Josef T. Prchal,
Blood, May 2013; 121: 3918 - 3924.
,PubMed ID 23538339
[Von Hippel Lindau]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC216151L1 | Lenti ORF clone of Human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC216151L2 | Lenti ORF clone of Human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC216151L3 | Lenti ORF clone of Human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC216151L4 | Lenti ORF clone of Human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RG216151 | VHL (tGFP-tagged) - Human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1 |
CNY 4,000.00 |
|
SC109881 | VHL (untagged)-Human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1 |
CNY 2,400.00 |
其它Von Hippel Lindau产品