SSBP1 (NM_003143) Human Tagged ORF Clone
CAT#: RC215106
SSBP1 (Myc-DDK-tagged)-Human single-stranded DNA binding protein 1 (SSBP1), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
"NM_003143" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | Mt-SSB; mtSSB; SOSS-B1; SSBP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC215106 representing NM_003143
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTTCGAAGACCTGTATTACAGGTACTTCGTCAGTTTGTAAGACATGAGTCCGAAACAACTACCAGTT TGGTTCTTGAAAGATCCCTGAATCGTGTGCACTTACTTGGGCGAGTGGGTCAGGACCCTGTCTTGAGACA GGTGGAAGGAAAAAATCCAGTCACAATATTTTCTCTAGCAACTAATGAGATGTGGCGATCAGGGGATAGT GAAGTTTACCAACTGGGTGATGTCAGTCAAAAGACAACATGGCACAGAATATCAGTATTCCGGCCAGGCC TCAGAGACGTGGCATATCAATATGTGAAAAAGGGGTCTCGAATTTATTTGGAAGGGAAAATAGACTATGG TGAATACATGGATAAAAATAATGTGAGGCGACAAGCAACAACAATCATAGCTGATAATATTATATTTCTG AGTGACCAGACGAAAGAGAAGGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC215106 representing NM_003143
Red=Cloning site Green=Tags(s) MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL SDQTKEKE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003143 |
ORF Size | 444 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003143.3 |
RefSeq Size | 628 bp |
RefSeq ORF | 447 bp |
Locus ID | 6742 |
UniProt ID | Q04837 |
Domains | SSB |
Protein Families | Druggable Genome |
Protein Pathways | DNA replication, Homologous recombination, Mismatch repair |
MW | 17.26 kDa |
Gene Summary | SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 19683501].[supplied by OMIM, Feb 2010] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Intramitochondrial Src kinase links mitochondrial dysfunctions and aggressiveness of breast cancer cells
,Djeungoue-Petga, MA;Lurette, O;Jean, S;Hamel-Côté, G;Martín-Jiménez, R;Bou, M;Cannich, A;Roy, P;Hebert-Chatelain, E;,
Cell Death Dis
,PubMed ID 31819039
[SSBP1]
|
Alpers disease mutations in human mitochondrial DNA polymerase cause catalytic defects in mitochondrial DNA replication by distinct mechanisms
,Qian, Y;Ziehr, J;Johnson, K;,
Name: Frontiers in Genetics
[SSBP1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC215106L1 | Lenti ORF clone of Human single-stranded DNA binding protein 1 (SSBP1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
CNY 4,200.00 |
|
RC215106L2 | Lenti ORF clone of Human single-stranded DNA binding protein 1 (SSBP1), nuclear gene encoding mitochondrial protein, mGFP tagged |
CNY 4,200.00 |
|
RC215106L3 | Lenti ORF clone of Human single-stranded DNA binding protein 1 (SSBP1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC215106L4 | Lenti ORF clone of Human single-stranded DNA binding protein 1 (SSBP1), nuclear gene encoding mitochondrial protein, mGFP tagged |
CNY 4,200.00 |
|
RG215106 | SSBP1 (tGFP-tagged) - Human single-stranded DNA binding protein 1 (SSBP1), nuclear gene encoding mitochondrial protein |
CNY 3,400.00 |
|
SC118188 | SSBP1 (untagged)-Human single-stranded DNA binding protein 1 (SSBP1), nuclear gene encoding mitochondrial protein |
CNY 1,800.00 |