SUMO4 (NM_001002255) Human Tagged ORF Clone
CAT#: RC213850
- TrueORF®
SUMO4 (Myc-DDK-tagged)-Human SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) (SUMO4)
ORF Plasmid: tGFP
"NM_001002255" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | dJ281H8.4; IDDM5; SMT3H4; SUMO-4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213850 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCAACGAAAAGCCCACAGAAGAAGTCAAGACTGAGAACAACAATCATATTAATTTGAAGGTGGCGG GACAGGATGGTTCTGTGGTGCAGTTTAAGATTAAGAGGCAGACACCACTTAGTAAACTAATGAAAGCCTA TTGTGAACCACGGGGATTGTCAGTGAAGCAGATCAGATTCCGATTTGGTGGGCAACCAATCAGTGGAACA GACAAACCTGCACAGTTGGAAATGGAAGATGAAGATACAATTGATGTGTTTCAACAGCCTACGGGAGGTG TCTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213850 protein sequence
Red=Cloning site Green=Tags(s) MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGT DKPAQLEMEDEDTIDVFQQPTGGVY TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001002255 |
ORF Size | 285 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001002255.2 |
RefSeq Size | 702 bp |
RefSeq ORF | 288 bp |
Locus ID | 387082 |
UniProt ID | Q6EEV6 |
MW | 10.7 kDa |
Gene Summary | This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213850L1 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) (SUMO4), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC213850L2 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) (SUMO4), mGFP tagged |
CNY 5,890.00 |
|
RC213850L3 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) (SUMO4), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC213850L4 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) (SUMO4), mGFP tagged |
CNY 5,890.00 |
|
RG213850 | SUMO4 (tGFP-tagged) - Human SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) (SUMO4) |
CNY 4,370.00 |
|
SC300420 | SUMO4 (untagged)-Human SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) (SUMO4) |
CNY 1,800.00 |