HMGN2 (NM_005517) Human Tagged ORF Clone
CAT#: RC212821
- TrueORF®
HMGN2 (Myc-DDK-tagged)-Human high mobility group nucleosomal binding domain 2 (HMGN2)
ORF Plasmid: tGFP
"NM_005517" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HMG17 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC212821 representing NM_005517
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCAAGAGAAAGGCTGAAGGGGATGCTAAGGGAGATAAAGCAAAGGTGAAGGACGAACCACAGAGAA GATCCGCGAGGTTGTCTGCTAAACCTGCTCCTCCAAAGCCAGAGCCCAAGCCTAAAAAGGCCCCTGCAAA GAAGGGAGAGAAGGTACCCAAAGGGAAAAAGGGAAAAGCTGATGCTGGCAAGGAGGGGAATAACCCTGCA GAAAATGGAGATGCCAAAACAGACCAGGCACAGAAAGCTGAAGGTGCTGGAGATGCCAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC212821 representing NM_005517
Red=Cloning site Green=Tags(s) MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPA ENGDAKTDQAQKAEGAGDAK myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005517 |
ORF Size | 270 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005517.4 |
RefSeq Size | 1306 bp |
RefSeq ORF | 273 bp |
Locus ID | 3151 |
UniProt ID | P05204 |
Domains | HMG14_17 |
Protein Families | Druggable Genome, Transcription Factors |
MW | 9.2 kDa |
Gene Summary | The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMGN1, the encoded protein may help maintain an open chromatin configuration around transcribable genes. The protein has also been found to have antimicrobial activity against bacteria, viruses and fungi. [provided by RefSeq, Oct 2014] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
HDAC6 Deacetylates HMGN2 to Regulate Stat5a Activity and Breast Cancer Growth
,Medler, TR;Craig, JM;Fiorillo, AA;Feeney, YB;Harrell, JC;Clevenger, CV;,
Mol. Cancer Res.
,PubMed ID 27358110
[HMGN2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC212821L1 | Lenti-ORF clone of HMGN2 (Myc-DDK-tagged)-Human high mobility group nucleosomal binding domain 2 (HMGN2) |
CNY 3,600.00 |
|
RC212821L2 | Lenti-ORF clone of HMGN2 (mGFP-tagged)-Human high mobility group nucleosomal binding domain 2 (HMGN2) |
CNY 5,890.00 |
|
RC212821L3 | Lenti-ORF clone of HMGN2 (Myc-DDK-tagged)-Human high mobility group nucleosomal binding domain 2 (HMGN2) |
CNY 5,890.00 |
|
RC212821L4 | Lenti-ORF clone of HMGN2 (mGFP-tagged)-Human high mobility group nucleosomal binding domain 2 (HMGN2) |
CNY 5,890.00 |
|
RG212821 | HMGN2 (tGFP-tagged) - Human high mobility group nucleosomal binding domain 2 (HMGN2) |
CNY 4,370.00 |
|
SC116703 | HMGN2 (untagged)-Human high mobility group nucleosomal binding domain 2 (HMGN2) |
CNY 1,200.00 |