CREBL2 (NM_001310) Human Tagged ORF Clone
CAT#: RC210722
CREBL2 (Myc-DDK-tagged)-Human cAMP responsive element binding protein-like 2 (CREBL2)
ORF Plasmid: tGFP
"NM_001310" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210722 representing NM_001310
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGATGACAGTAAGGTGGTTGGAGGCAAAGTAAAGAAGCCCGGTAAACGTGGTCGGAAGCCAGCCAAAA TTGACTTGAAAGCAAAACTTGAGAGGAGCCGGCAGAGTGCAAGAGAATGCCGAGCCCGAAAAAAGCTGAG ATATCAGTATTTGGAAGAGTTGGTATCCAGTCGAGAAAGAGCTATATGTGCCCTCAGAGAGGAACTGGAA ATGTACAAGCAGTGGTGCATGGCAATGGACCAAGGAAAAATCCCTTCTGAAATAAAGGCCCTACTCACTG GAGAAGAGCAGAACAAATCTCAGCAGAACTCAAGCAGGCATACCAAGGCTGGGAAGACAGATGCTAATAG CAATTCCTGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210722 representing NM_001310
Red=Cloning site Green=Tags(s) MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRERAICALREELE MYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001310 |
ORF Size | 360 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001310.4 |
RefSeq Size | 3748 bp |
RefSeq ORF | 363 bp |
Locus ID | 1389 |
UniProt ID | O60519 |
Protein Families | Transcription Factors |
MW | 13.6 kDa |
Gene Summary | cAMP response element (CRE)-binding protein-like-2 (CREBL2) was identified in a search to find genes in a commonly deleted region on chromosome 12p13 flanked by ETV6 and CDKN1B genes, frequently associated with hematopoietic malignancies, as well as breast, non-small-cell lung and ovarian cancers. CREBL2 shares a 41% identity with CRE-binding protein (CREB) over a 48-base long region which encodes the bZip domain of CREB. The bZip domain consists of about 30 amino acids rich in basic residues involved in DNA binding, followed by a leucine zipper motif involved in protein dimerization. This suggests that CREBL2 encodes a protein with DNA binding capabilities. The occurance of CREBL2 deletion in malignancy suggests that CREBL2 may act as a tumor suppressor gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210722L1 | Lenti ORF clone of Human cAMP responsive element binding protein-like 2 (CREBL2), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC210722L2 | Lenti ORF clone of Human cAMP responsive element binding protein-like 2 (CREBL2), mGFP tagged |
CNY 5,890.00 |
|
RC210722L3 | Lenti ORF clone of Human cAMP responsive element binding protein-like 2 (CREBL2), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC210722L4 | Lenti ORF clone of Human cAMP responsive element binding protein-like 2 (CREBL2), mGFP tagged |
CNY 5,890.00 |
|
RG210722 | CREBL2 (tGFP-tagged) - Human cAMP responsive element binding protein-like 2 (CREBL2) |
CNY 4,370.00 |
|
SC119296 | CREBL2 (untagged)-Human cAMP responsive element binding protein-like 2 (CREBL2) |
CNY 1,200.00 |