Macrophage Inflammatory Protein 4 (CCL18) (NM_002988) Human Tagged ORF Clone
CAT#: RC210245
CCL18 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18)
ORF Plasmid: tGFP
"NM_002988" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210245 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGGGCCTTGCAGCTGCCCTCCTTGTCCTCGTCTGCACCATGGCCCTCTGCTCCTGTGCACAAGTTG GTACCAACAAAGAGCTCTGCTGCCTCGTCTATACCTCCTGGCAGATTCCACAAAAGTTCATAGTTGACTA TTCTGAAACCAGCCCCCAGTGCCCCAAGCCAGGTGTCATCCTCCTAACCAAGAGAGGCCGGCAGATCTGT GCTGACCCCAATAAGAAGTGGGTCCAGAAATACATCAGCGACCTGAAGCTGAATGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210245 protein sequence
Red=Cloning site Green=Tags(s) MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC ADPNKKWVQKYISDLKLNA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002988 |
ORF Size | 267 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002988.4 |
RefSeq Size | 798 bp |
RefSeq ORF | 270 bp |
Locus ID | 6362 |
UniProt ID | P55774 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
MW | 9.8 kDa |
Gene Summary | This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq, Sep 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210245L1 | Lenti ORF clone of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC210245L2 | Lenti ORF clone of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mGFP tagged |
CNY 5,890.00 |
|
RC210245L3 | Lenti ORF clone of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC210245L4 | Lenti ORF clone of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mGFP tagged |
CNY 5,890.00 |
|
RG210245 | CCL18 (tGFP-tagged) - Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18) |
CNY 2,800.00 |
|
SC303259 | CCL18 (untagged)-Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18) |
CNY 3,990.00 |
其它Macrophage Inflammatory Protein 4产品