IL3 (NM_000588) Human Tagged ORF Clone
CAT#: RC210109
IL3 (Myc-DDK-tagged)-Human interleukin 3 (colony-stimulating factor, multiple) (IL3)
ORF Plasmid: tGFP
"NM_000588" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | IL-3; MCGF; MULTI-CSF |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210109 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCCGCCTGCCCGTCCTGCTCCTGCTCCAACTCCTGGTCCGCCCCGGACTCCAAGCTCCCATGACCC AGACAACGCCCTTGAAGACAAGCTGGGTTAACTGCTCTAACATGATCGATGAAATTATAACACACTTAAA GCAGCCACCTTTGCCTTTGCTGGACTTCAACAACCTCAATGGGGAAGACCAAGACATTCTGATGGAAAAT AACCTTCGAAGGCCAAACCTGGAGGCATTCAACAGGGCTGTCAAGAGTTTACAGAACGCATCAGCAATTG AGAGCATTCTTAAAAATCTCCTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACGCGACATCCAATCCA TATCAAGGACGGTGACTGGAATGAATTCCGGAGGAAACTGACGTTCTATCTGAAAACCCTTGAGAATGCG CAGGCTCAACAGACGACTTTGAGCCTCGCGATCTTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210109 protein sequence
Red=Cloning site Green=Tags(s) MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMEN NLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENA QAQQTTLSLAIF myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_000588 |
ORF Size | 456 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000588.4 |
RefSeq Size | 924 bp |
RefSeq ORF | 459 bp |
Locus ID | 3562 |
UniProt ID | P08700 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Apoptosis, Asthma, Cytokine-cytokine receptor interaction, Fc epsilon RI signaling pathway, Hematopoietic cell lineage, Jak-STAT signaling pathway |
MW | 17.2 kDa |
Gene Summary | The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Rapid generation of gene-targeted EPS-derived mouse models through tetraploid complementation
,Li, H;Zhao, C;Xu, J;Xu, Y;Cheng, C;Liu, Y;Wang, T;Du, Y;Xie, L;Zhao, J;Han, Y;Wang, X;Bai, Y;Deng, H;,
Protein Cell
,PubMed ID 29948855
[IL3]
|
An AAV Vector-Mediated Gene Delivery Approach Facilitates Reconstitution of Functional Human CD8(+) T Cells in Mice
,Huang, J;Li, X;Coelho-Dos-Reis, JG;Wilson, JM;Tsuji, M;,
PLoS ONE, Feb 2014.
,PubMed ID 24516613
[IL3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210109L1 | Lenti ORF clone of Human interleukin 3 (colony-stimulating factor, multiple) (IL3), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC210109L2 | Lenti ORF clone of Human interleukin 3 (colony-stimulating factor, multiple) (IL3), mGFP tagged |
CNY 5,890.00 |
|
RC210109L3 | Lenti ORF clone of Human interleukin 3 (colony-stimulating factor, multiple) (IL3), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC210109L4 | Lenti ORF clone of Human interleukin 3 (colony-stimulating factor, multiple) (IL3), mGFP tagged |
CNY 4,200.00 |
|
RG210109 | IL3 (tGFP-tagged) - Human interleukin 3 (colony-stimulating factor, multiple) (IL3) |
CNY 3,400.00 |
|
SC300103 | IL3 (untagged)-Human interleukin 3 (colony-stimulating factor, multiple) (IL3) |
CNY 1,200.00 |