TOMM7 (NM_019059) Human Tagged ORF Clone
CAT#: RC210040
TOMM7 (Myc-DDK-tagged)-Human translocase of outer mitochondrial membrane 7 homolog (yeast) (TOMM7), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
"NM_019059" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | TOM7 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210040 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGAAGCTGAGCAAAGAGGCCAAGCAGAGACTACAGCAGCTCTTCAAGGGGAGCCAGTTTGCCATTC GCTGGGGCTTTATCCCTCTTGTGATTTACCTGGGATTTAAGAGGGGTGCAGATCCCGGAATGCCTGAACC AACTGTTTTGAGCCTACTTTGGGGA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210040 protein sequence
Red=Cloning site Green=Tags(s) MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_019059 |
ORF Size | 165 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_019059.5 |
RefSeq Size | 796 bp |
RefSeq ORF | 168 bp |
Locus ID | 54543 |
UniProt ID | Q9P0U1 |
Protein Families | Transmembrane |
MW | 6.2 kDa |
Gene Summary | This gene encodes a subunit of the translocase of the outer mitochondrial membrane. The encoded protein regulates the assembly and stability of the translocase complex. [provided by RefSeq, Oct 2012] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
A novel role of KEAP1/PGAM5 complex: ROS sensor for inducing mitophagy
,null,
Redox Biology
,PubMed ID 34801863
[TOMM7]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210040L3 | Lenti ORF clone of Human translocase of outer mitochondrial membrane 7 homolog (yeast) (TOMM7), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC210040L4 | Lenti ORF clone of Human translocase of outer mitochondrial membrane 7 homolog (yeast) (TOMM7), nuclear gene encoding mitochondrial protein, mGFP tagged |
CNY 5,890.00 |
|
RG210040 | TOMM7 (tGFP-tagged) - Human translocase of outer mitochondrial membrane 7 homolog (yeast) (TOMM7), nuclear gene encoding mitochondrial protein |
CNY 2,800.00 |
|
SC113263 | TOMM7 (untagged)-Human translocase of outer mitochondrial membrane 7 homolog (yeast) (TOMM7), nuclear gene encoding mitochondrial protein |
CNY 1,200.00 |