United States
Germany
Japan
United Kingdom
China
c-Jun (JUN) (NM_002228) Human Tagged ORF Clone
CAT＃: RC209804
JUN (Myc-DDK-tagged)-Human jun proto-oncogene (JUN)
ORF Plasmid: tGFP
"NM_002228" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,990.00
| Cited in 14 publications. |
Product images
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | AP-1; AP1; c-Jun; cJUN; p39 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC209804 representing NM_002228
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTGCAAAGATGGAAACGACCTTCTATGACGATGCCCTCAACGCCTCGTTCCTCCCGTCCGAGAGCG GACCTTATGGCTACAGTAACCCCAAGATCCTGAAACAGAGCATGACCCTGAACCTGGCCGACCCAGTGGG GAGCCTGAAGCCGCACCTCCGCGCCAAGAACTCGGACCTCCTCACCTCGCCCGACGTGGGGCTGCTCAAG CTGGCGTCGCCCGAGCTGGAGCGCCTGATAATCCAGTCCAGCAACGGGCACATCACCACCACGCCGACCC CCACCCAGTTCCTGTGCCCCAAGAACGTGACAGATGAGCAGGAGGGCTTCGCCGAGGGCTTCGTGCGCGC CCTGGCCGAACTGCACAGCCAGAACACGCTGCCCAGCGTCACGTCGGCGGCGCAGCCGGTCAACGGGGCA GGCATGGTGGCTCCCGCGGTAGCCTCGGTGGCAGGGGGCAGCGGCAGCGGCGGCTTCAGCGCCAGCCTGC ACAGCGAGCCGCCGGTCTACGCAAACCTCAGCAACTTCAACCCAGGCGCGCTGAGCAGCGGCGGCGGGGC GCCCTCCTACGGCGCGGCCGGCCTGGCCTTTCCCGCGCAACCCCAGCAGCAGCAGCAGCCGCCGCACCAC CTGCCCCAGCAGATGCCCGTGCAGCACCCGCGGCTGCAGGCCCTGAAGGAGGAGCCTCAGACAGTGCCCG AGATGCCCGGCGAGACACCGCCCCTGTCCCCCATCGACATGGAGTCCCAGGAGCGGATCAAGGCGGAGAG GAAGCGCATGAGGAACCGCATCGCTGCCTCCAAGTGCCGAAAAAGGAAGCTGGAGAGAATCGCCCGGCTG GAGGAAAAAGTGAAAACCTTGAAAGCTCAGAACTCGGAGCTGGCGTCCACGGCCAACATGCTCAGGGAAC AGGTGGCACAGCTTAAACAGAAAGTCATGAACCACGTTAACAGTGGGTGCCAACTCATGCTAACGCAGCA GTTGCAAACATTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209804 representing NM_002228
Red=Cloning site Green=Tags(s) MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK LASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGA GMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHH LPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARL EEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_002228 |
| ORF Size | 993 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_002228.4 |
| RefSeq Size | 3338 bp |
| RefSeq ORF | 996 bp |
| Locus ID | 3725 |
| UniProt ID | P05412 |
| Domains | BRLZ, Jun |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
| Protein Pathways | B cell receptor signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, GnRH signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Renal cell carcinoma, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Wnt signaling pathway |
| MW | 35.5 kDa |
| Gene Summary | This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq, Jul 2008] |
Citations (14)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
The endoplasmic reticulum acetyltransferases ATase1/NAT8B and ATase2/NAT8 are differentially regulated to adjust engagement of the secretory pathway
,null,
Journal of neurochemistry
,PubMed ID 31945187
[c-Jun]
|
|
High-resolution protein–protein interaction mapping using all-versus-all sequencing (AVA-Seq)
,null,
The Journal of Biological Chemistry
,PubMed ID 31182485
[c-Jun]
|
|
HDAC8 regulates a stress response pathway in melanoma to mediate escape from BRAF inhibitor therapy
,Emmons, MF;Faião-Flores, F;Sharma, R;Thapa, R;Messina, JL;Becker, JC;Schadendorf, D;Seto, E;Sondak, VK;Koomen, JM;Chen, YA;Lau, EK;Wan, L;Licht, JD;Smalley, KSM;,
Cancer Res.
,PubMed ID 30987999
[c-Jun]
|
|
Endogenous interaction profiling identifies DDX5 as an oncogenic coactivator of transcription factor Fra-1
,He, H;Song, D;Sinha, I;Hessling, B;Li, X;Haldosen, LA;Zhao, C;,
Oncogene
,PubMed ID 31015574
[c-Jun]
|
|
Interference with NTSR1 Expression Exerts an Anti-Invasion Effect via the Jun/miR-494/SOCS6 Axis of Glioblastoma Cells
,Ou-Yang, Q;He, X;Yang, A;Li, B;Xu, M;,
Cell. Physiol. Biochem.
,PubMed ID 30261490
[c-Jun]
|
|
IRF4 haploinsufficiency in a family with Whipple's disease
,Guérin, A;Kerner, G;Marr, N;Markle, JG;Fenollar, F;Wong, N;Boughorbel, S;Avery, DT;Ma, CS;Bougarn, S;Bouaziz, M;Béziat, V;Della Mina, E;Oleaga-Quintas, C;Lazarov, T;Worley, L;Nguyen, T;Patin, E;Deswarte, C;Martinez-Barricarte, R;Boucherit, S;Ayral, X;Edouard, S;Boisson-Dupuis, S;Rattina, V;Bigio, B;Vogt, G;Geissmann, F;Quintana-Murci, L;Chaussabel, D;Tangye, SG;Raoult, D;Abel, L;Bustamante, J;Casanova, JL;,
Elife
,PubMed ID 29537367
[c-Jun]
|
|
c-Fos mediates α1, 2-fucosyltransferase 1 and Lewis y expression in response to TGF-β1 in ovarian cancer
,Hao, Y;Zhu, L;Yan, L;Liu, J;Liu, D;Gao, N;Tan, M;Gao, S;Lin, B;,
Oncology Reports
,PubMed ID 29130097
[c-Jun]
|
|
Diabetes and risk of Kaposi's sarcoma: effects of high glucose on reactivation and infection of Kaposi's sarcoma-associated herpesvirus
,Chang, P;Yang, Y;Chen, P;Chen, L;Wang, S;Shih, Y;Chen, L;Chen, C;Lin, CH;,
Oncotarget
[c-Jun]
|
|
Regulation of c-Maf and aA-crystallin in Ocular Lens by FGF Signaling
,Xie, Q;McGreal, R;Harris, R;Gao, CY;Liu, W;Reneker, LW;Musil, LS;Cvekl, A;,
J. Biol. Chem.
,PubMed ID 26719333
[c-Jun]
|
|
The ATP-binding cassette transporter-2 (ABCA2) overexpression modulates sphingosine levels and transcription of the amyloid precursor protein (APP) gene
,Davis Jr, W;,
Current Alzheimer research
,PubMed ID 26510981
[c-Jun]
|
|
The membrane protein melanoma cell adhesion molecule (MCAM) is a novel tumor marker that stimulates tumorigenesis in hepatocellular carcinoma
,Wang, J;Tang, X;Weng, W;Qiao, Y;Lin, J;Liu, W;Liu, R;Ma, L;Yu, W;Yu, Y;Pan, Q;Sun, F;,
Oncogene
,PubMed ID 25728681
[c-Jun]
|
|
c-Jun transcriptionally regulates alpha 1, 2-fucosyltransferase 1 (FUT1) in ovarian cancer
,Gao, N;Liu, J;Liu, D;Hao, Y;Yan, L;Ma, Y;Zhuang, H;Hu, Z;Gao, J;Yang, Z;Shi, H;Lin, B;,
Biochimie
,PubMed ID 25239830
[c-Jun]
|
|
JUN-CCAAT/Enhancer-Binding Protein Complexes Inhibit Surfactant-Associated Protein B Promoter Activity
,Kiflai Bein, Hayley Leight, and George D. Leikauf,
Am. J. Respir. Cell Mol. Biol., Aug 2011; 45: 436 - 444.
[c-Jun]
|
|
Liver X Receptor-Retinoid X Receptor (LXR-RXR) Heterodimer Cistrome Reveals Coordination of LXR and AP1 Signaling in Keratinocytes
,Qi Shen, Yuchen Bai, Ken C. N. Chang, Yongjun Wang, Thomas P. Burris, Leonard P. Freedman, Catherine C. Thompson, and Sunil Nagpal,
J. Biol. Chem., Apr 2011; 286: 14554 - 14563
[c-Jun]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC209804L1 | Lenti ORF clone of Human jun proto-oncogene (JUN), Myc-DDK-tagged |
CNY 4,800.00 |
|
| RC209804L2 | Lenti ORF clone of Human jun proto-oncogene (JUN), mGFP tagged |
CNY 5,890.00 |
|
| RC209804L3 | Lenti ORF clone of Human jun proto-oncogene (JUN), Myc-DDK-tagged |
CNY 4,800.00 |
|
| RC209804L4 | Lenti ORF clone of Human jun proto-oncogene (JUN), mGFP tagged |
CNY 4,800.00 |
|
| RG209804 | JUN (tGFP-tagged) - Human jun proto-oncogene (JUN) |
CNY 4,000.00 |
|
| SC118762 | JUN (untagged)-Human jun proto-oncogene (JUN) |
CNY 2,400.00 |
