ARP10 (APOBEC3H) (NM_181773) Human Tagged ORF Clone
CAT#: RC209663
- TrueORF®
APOBEC3H (Myc-DDK-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2
ORF Plasmid: tGFP
"NM_181773" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 5,616.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | A3H; ARP-10; ARP10 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209663 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTCTGTTAACAGCCGAAACATTCCGCTTACAGTTTAACAACAAGCGCCGCCTCAGAAGGCCTTACT ACCCGAGGAAGGCCCTCTTGTGTTACCAGCTGACGCCGCAGAATGGCTCCACGCCCACGAGAGGCTACTT TGAAAACAAGAAAAAGTGCCATGCAGAAATTTGCTTTATTAACGAGATCAAGTCCATGGGACTGGACGAA ACGCAGTGCTACCAAGTCACCTGTTACCTCACGTGGAGCCCCTGCTCCTCCTGTGCCTGGGAGCTGGTTG ACTTCATCAAGGCTCACGACCATCTGAACCTGGGCATCTTCGCCTCCCGCCTGTACTACCACTGGTGCAA GCCCCAGCAGAAGGGGCTGCGGCTTCTGTGTGGATCCCAGGTCCCGGTGGAGGTCATGGGCTTCCCAGAG TTTGCTGACTGCTGGGAAAACTTTGTGGACCACGAGAAACCGCTTTCCTTCAACCCCTATAAGATGTTAG AGGAGCTAGATAAAAACAGTCGAGCCATAAAGCGACGGCTTGAGAGGATAAAGTCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209663 protein sequence
Red=Cloning site Green=Tags(s) MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDE TQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPE FADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_181773 |
ORF Size | 1509 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_181773.5 |
RefSeq Size | 1070 bp |
RefSeq ORF | 552 bp |
Locus ID | 164668 |
UniProt ID | Q6NTF7 |
MW | 21.5 kDa |
Gene Summary | This gene encodes a member of the apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 family of proteins. The encoded protein is a cytidine deaminase that has antiretroviral activity by generating lethal hypermutations in viral genomes. Polymorphisms and alternative splicing in this gene influence its antiretroviral activity and are associated with increased resistence to human immunodeficiency virus type 1 infection in certain populations. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
APOBEC3-induced mutation of the hepatitis virus B DNA genome occurs during its viral RNA reverse transcription into (-)-DNA
,Chen, Z;Eggerman, TL;Bocharov, AV;Baranova, IN;Vishnyakova, TG;Patterson, AP;,
The Journal of biological chemistry
,PubMed ID 34181944
[APOBEC3H]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209663L3 | Lenti-ORF clone of APOBEC3H (Myc-DDK-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2 |
CNY 5,890.00 |
|
RC209663L4 | Lenti-ORF clone of APOBEC3H (mGFP-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2 |
CNY 5,890.00 |
|
RG209663 | APOBEC3H (tGFP-tagged) - Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2 |
CNY 4,370.00 |
|
SC319818 | APOBEC3H (untagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2 |
CNY 2,400.00 |