TXN (NM_003329) Human Tagged ORF Clone
CAT#: RC208876
TXN (Myc-DDK-tagged)-Human thioredoxin (TXN)
ORF Plasmid: tGFP
"NM_003329" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | TRDX; TRX; TRX1; Trx80 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC208876 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGAAGCAGATCGAGAGCAAGACTGCTTTTCAGGAAGCCTTGGACGCTGCAGGTGATAAACTTGTAG TAGTTGACTTCTCAGCCACGTGGTGTGGGCCTTGCAAAATGATCAAGCCTTTCTTTCATTCCCTCTCTGA AAAGTATTCCAACGTGATATTCCTTGAAGTAGATGTGGATGACTGTCAGGATGTTGCTTCAGAGTGTGAA GTCAAATGCATGCCAACATTCCAGTTTTTTAAGAAGGGACAAAAGGTGGGTGAATTTTCTGGAGCCAATA AGGAAAAGCTTGAAGCCACCATTAATGAATTAGTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC208876 protein sequence
Red=Cloning site Green=Tags(s) MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003329 |
ORF Size | 315 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_003329.4 |
RefSeq Size | 886 bp |
RefSeq ORF | 318 bp |
Locus ID | 7295 |
UniProt ID | P10599 |
Domains | thiored |
Protein Families | Druggable Genome |
MW | 11.7 kDa |
Gene Summary | The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Dimethoxycurcumin, a metabolically stable analogue of curcumin enhances the radiosensitivity of cancer cells: Possible involvement of ROS and thioredoxin reductase
,Jayakumar, S;Patwardhan, RS;Pal, D;Sharma, D;Sandur, SK;,
Biochem. Biophys. Res. Commun.
,PubMed ID 27381867
[TXN]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC208876L1 | Lenti ORF clone of Human thioredoxin (TXN), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC208876L2 | Lenti ORF clone of Human thioredoxin (TXN), mGFP tagged |
CNY 5,890.00 |
|
RC208876L3 | Lenti ORF clone of Human thioredoxin (TXN), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC208876L4 | Lenti ORF clone of Human thioredoxin (TXN), mGFP tagged |
CNY 4,200.00 |
|
RG208876 | TXN (tGFP-tagged) - Human thioredoxin (TXN) |
CNY 3,400.00 |
|
SC118039 | TXN (untagged)-Human thioredoxin (TXN) |
CNY 1,800.00 |