United States
Germany
Japan
United Kingdom
China
beta 2 Microglobulin (B2M) (NM_004048) Human Tagged ORF Clone
CAT＃: RC207587
B2M (Myc-DDK-tagged)-Human beta-2-microglobulin (B2M)
ORF Plasmid: tGFP
"NM_004048" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
| Cited in 4 publications. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | IMD43 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC207587 representing NM_004048
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGCTATCCAGCGTA CTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGT GTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAG CATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTG AAAAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCG AGACATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC207587 representing NM_004048
Red=Cloning site Green=Tags(s) MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVE HSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_004048 |
| ORF Size | 357 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_004048.4 |
| RefSeq Size | 987 bp |
| RefSeq ORF | 360 bp |
| Locus ID | 567 |
| UniProt ID | P61769 |
| Domains | ig, IGc1 |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Antigen processing and presentation |
| MW | 13.71 kDa |
| Gene Summary | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.[provided by RefSeq, Aug 2014] |
Citations (4)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
A TNFR2-Specific TNF Fusion Protein With Improved In Vivo Activity
,null,
Frontiers in Immunology
,PubMed ID 35769484
[beta 2 Microglobulin]
|
|
Development of a label-free FcRn-mediated transcytosis assay for in vitro characterization of FcRn interactions with therapeutic antibodies and Fc-fusion proteins
,Chung, S;Lin, YL;Nguyen, V;Kamen, L;Zheng, K;Vora, B;Song, A;,
J. Immunol. Methods
,PubMed ID 30030147
[beta 2 Microglobulin]
|
|
Evidence of activation of the Nrf2 pathway in multiple sclerosis patients treated with delayed-release dimethyl fumarate in the Phase 3 DEFINE and CONFIRM studies
,Gopal, S;Mikulskis, A;Gold, R;Fox, RJ;Dawson, KT;Amaravadi, L;,
Mult. Scler
,PubMed ID 28156185
[beta 2 Microglobulin]
|
|
Key Residues at Third CDR3ß Position Impact Structure and Antigen Recognition of Human Invariant NK TCRs
,Chamoto, K;Guo, T;Scally, SW;Kagoya, Y;Ancruzowski, M;Wang, CH;Rahman, MA;Saso, K;Butler, MO;Chiu, PP;Julien, JP;Hirano, N;,
J. Immunol
,PubMed ID 28003379
[beta 2 Microglobulin]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC207587L1 | Lenti ORF clone of Human beta-2-microglobulin (B2M), Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC207587L2 | Lenti ORF clone of Human beta-2-microglobulin (B2M), mGFP tagged |
CNY 5,890.00 |
|
| RC207587L3 | Lenti ORF clone of Human beta-2-microglobulin (B2M), Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC207587L4 | Lenti ORF clone of Human beta-2-microglobulin (B2M), mGFP tagged |
CNY 3,600.00 |
|
| RG207587 | B2M (tGFP-tagged) - Human beta-2-microglobulin (B2M) |
CNY 2,800.00 |
|
| SC117632 | B2M (untagged)-Human beta-2-microglobulin (B2M) |
CNY 1,200.00 |
其它beta 2 Microglobulin产品
