Peroxiredoxin 2 (PRDX2) (NM_005809) Human Tagged ORF Clone
CAT#: RC207413
PRDX2 (Myc-DDK-tagged)-Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1
ORF Plasmid: tGFP
"NM_005809" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HEL-S-2a; NKEF-B; NKEFB; PRP; PRX2; PRXII; PTX1; TDPX1; TPX1; TSA |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC207413 representing NM_005809
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCTCCGGTAACGCGCGCATCGGAAAGCCAGCCCCTGACTTCAAGGCCACAGCGGTGGTTGATGGCG CCTTCAAAGAGGTGAAGCTGTCGGACTACAAAGGGAAGTACGTGGTCCTCTTTTTCTACCCTCTGGACTT CACTTTTGTGTGCCCCACCGAGATCATCGCGTTCAGCAACCGTGCAGAGGACTTCCGCAAGCTGGGCTGT GAAGTGCTGGGCGTCTCGGTGGACTCTCAGTTCACCCACCTGGCTTGGATCAACACCCCCCGGAAAGAGG GAGGCTTGGGCCCCCTGAACATCCCCCTGCTTGCTGACGTGACCAGACGCTTGTCTGAGGATTACGGCGT GCTGAAAACAGATGAGGGCATTGCCTACAGGGGCCTCTTTATCATCGATGGCAAGGGTGTCCTTCGCCAG ATCACTGTTAATGATTTGCCTGTGGGACGCTCCGTGGATGAGGCTCTGCGGCTGGTCCAGGCCTTCCAGT ACACAGACGAGCATGGGGAAGTTTGTCCCGCTGGCTGGAAGCCTGGCAGTGACACGATTAAGCCCAACGT GGATGACAGCAAGGAATATTTCTCCAAACACAAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC207413 representing NM_005809
Red=Cloning site Green=Tags(s) MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQ ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005809 |
ORF Size | 594 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_005809.6 |
RefSeq Size | 1039 bp |
RefSeq ORF | 597 bp |
Locus ID | 7001 |
UniProt ID | P32119 |
Domains | AhpC-TSA |
Protein Families | Druggable Genome |
MW | 21.7 kDa |
Gene Summary | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13. [provided by RefSeq, Mar 2013] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Identification of Targets from LRRK2 Rescue Phenotypes
,Toh, J;Chua, LL;Ho, P;Sandanaraj, E;Tang, C;Wang, H;Tan, EK;,
Cells
,PubMed ID 33466414
[Peroxiredoxin 2]
|
Chetomin rescues pathogenic phenotype of LRRK2 mutation in drosophila
,Chua, LL;Ho, P;Toh, J;Tan, EK;,
Aging (Albany NY) 2020
,PubMed ID 32990658
[Peroxiredoxin 2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC207413L1 | Lenti ORF clone of Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC207413L2 | Lenti ORF clone of Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC207413L3 | Lenti ORF clone of Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC207413L4 | Lenti ORF clone of Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RG207413 | PRDX2 (tGFP-tagged) - Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 4,000.00 |
|
SC116505 | PRDX2 (untagged)-Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 2,400.00 |
其它Peroxiredoxin 2产品