Kisspeptin (KISS1) (NM_002256) Human Tagged ORF Clone
CAT#: RC206859
KISS1 (Myc-DDK-tagged)-Human KiSS-1 metastasis-suppressor (KISS1)
ORF Plasmid: tGFP
"NM_002256" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HH13; KiSS-1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC206859 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACTCACTGGTTTCTTGGCAGCTACTGCTTTTCCTCTGTGCCACCCACTTTGGGGAGCCATTAGAAA AGGTGGCCTCTGTGGGGAATTCTAGACCCACAGGCCAGCAGCTAGAATCCCTGGGCCTCCTGGCCCCCGG GGAGCAGAGCCTGCCGTGCACCGAGAGGAAGCCAGCTGCTACTGCCAGGCTGAGCCGTCGGGGGACCTCG CTGTCCCCGCCCCCCGAGAGCTCCGGGAGCCCCCAGCAGCCGGGCCTGTCCGCCCCCCACAGCCGCCAGA TCCCCGCACCCCAGGGCGCGGTGCTGGTGCAGCGGGAGAAGGACCTGCCGAACTACAACTGGAACTCCTT CGGCCTGCGCTTCGGCAAGCGGGAGGCGGCACCAGGGAACCACGGCAGAAGCGCTGGGCGGGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC206859 protein sequence
Red=Cloning site Green=Tags(s) MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTS LSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002256 |
ORF Size | 414 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002256.4 |
RefSeq Size | 731 bp |
RefSeq ORF | 417 bp |
Locus ID | 3814 |
UniProt ID | Q15726 |
Protein Families | Druggable Genome, Secreted Protein |
MW | 14.7 kDa |
Gene Summary | This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues. [provided by RefSeq, Mar 2012] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC206859L1 | Lenti ORF clone of Human KiSS-1 metastasis-suppressor (KISS1), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC206859L2 | Lenti ORF clone of Human KiSS-1 metastasis-suppressor (KISS1), mGFP tagged |
CNY 5,890.00 |
|
RC206859L3 | Lenti ORF clone of Human KiSS-1 metastasis-suppressor (KISS1), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC206859L4 | Lenti ORF clone of Human KiSS-1 metastasis-suppressor (KISS1), mGFP tagged |
CNY 4,200.00 |
|
RG206859 | KISS1 (tGFP-tagged) - Human KiSS-1 metastasis-suppressor (KISS1) |
CNY 4,370.00 |
|
SC122622 | KISS1 (untagged)-Human KiSS-1 metastasis-suppressor (KISS1) |
CNY 1,200.00 |
其它Kisspeptin产品