United States
Germany
Japan
United Kingdom
China
Exodus 2 (CCL21) (NM_002989) Human Tagged ORF Clone
CAT＃: RC206579
CCL21 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 21 (CCL21)
ORF Plasmid: tGFP
"NM_002989" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
| Cited in 1 publication. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | 6Ckine; CKb9; ECL; SCYA21; SLC; TCA4 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC206579 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTCAGTCACTGGCTCTGAGCCTCCTTATCCTGGTTCTGGCCTTTGGCATCCCCAGGACCCAAGGCA GTGATGGAGGGGCTCAGGACTGTTGCCTCAAGTACAGCCAAAGGAAGATTCCCGCCAAGGTTGTCCGCAG CTACCGGAAGCAGGAACCAAGCTTAGGCTGCTCCATCCCAGCTATCCTGTTCTTGCCCCGCAAGCGCTCT CAGGCAGAGCTATGTGCAGACCCAAAGGAGCTCTGGGTGCAGCAGCTGATGCAGCATCTGGACAAGACAC CATCCCCACAGAAACCAGCCCAGGGCTGCAGGAAGGACAGGGGGGCCTCCAAGACTGGCAAGAAAGGAAA GGGCTCCAAAGGCTGCAAGAGGACTGAGCGGTCACAGACCCCTAAAGGGCCA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC206579 protein sequence
Red=Cloning site Green=Tags(s) MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRS QAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_002989 |
| ORF Size | 402 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_002989.4 |
| RefSeq Size | 913 bp |
| RefSeq ORF | 405 bp |
| Locus ID | 6366 |
| UniProt ID | O00585 |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
| MW | 14.6 kDa |
| Gene Summary | This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq, Sep 2014] |
Citations (1)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
The role of CCL21/CCR7 chemokine axis in breast cancer-induced lymphangiogenesis
,null,
Molecular Cancer
,PubMed ID 25744065
[Exodus 2]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC206579L1 | Lenti ORF clone of Human chemokine (C-C motif) ligand 21 (CCL21), Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC206579L2 | Lenti ORF clone of Human chemokine (C-C motif) ligand 21 (CCL21), mGFP tagged |
CNY 3,600.00 |
|
| RC206579L3 | Lenti ORF clone of Human chemokine (C-C motif) ligand 21 (CCL21), Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC206579L4 | Lenti ORF clone of Human chemokine (C-C motif) ligand 21 (CCL21), mGFP tagged |
CNY 3,600.00 |
|
| RG206579 | CCL21 (tGFP-tagged) - Human chemokine (C-C motif) ligand 21 (CCL21) |
CNY 2,800.00 |
|
| SC122641 | CCL21 (untagged)-Human chemokine (C-C motif) ligand 21 (CCL21) |
CNY 1,200.00 |
其它Exodus 2产品
