TMEM47 (NM_031442) Human Tagged ORF Clone

CAT#: RC205971

TMEM47 (Myc-DDK-tagged)-Human transmembrane protein 47 (TMEM47)

ORF Plasmid: DDK tGFP



  "NM_031442" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 3,600.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms BCMP1; TM4SF10; VAB-9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205971 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCGGCGGGCAGCGGCATGGAGGAGGTGCGCGTGTCGGTGCTGACCCCCTTGAAGCTGGTCGGGC
TGGTGTGCATCTTCCTGGCGCTGTGTCTGGACCTGGGGGCGGTGCTGAGCCCGGCCTGGGTCACAGCTGA
CCACCAGTACTACCTGTCGTTGTGGGAGTCCTGCCGCAAACCCGCCAGCTTGGACATCTGGCACTGCGAG
TCCACGCTCAGCAGCGATTGGCAGATTGCTACTCTGGCTTTACTCCTGGGCGGCGCTGCCATCATTCTCA
TTGCATTCCTGGTGGGTTTGATTTCTATCTGCGTGGGATCTCGAAGGCGTTTCTATAGACCTGTTGCGGT
CATGCTTTTTGCAGCAGTTGTTTTACAGGTTTGCAGCCTGGTCCTTTACCCAATCAAGTTCATTGAAACT
GTGAGCTTGAAAATTTACCATGAGTTCAACTGGGGTTATGGCCTGGCCTGGGGTGCAACTATATTTTCGT
TTGGGGGTGCCATCCTTTATTGCCTGAACCCTAAGAACTATGAAGACTACTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205971 protein sequence
Red=Cloning site Green=Tags(s)

MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRKPASLDIWHCE
STLSSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLFAAVVLQVCSLVLYPIKFIET
VSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_031442
ORF Size 543 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_031442.2, NP_113630.1
RefSeq Size 4068 bp
RefSeq ORF 546 bp
Locus ID 83604
UniProt ID Q9BQJ4
Protein Families Transmembrane
MW 20 kDa
Gene Summary This gene encodes a member of the PMP22/EMP/claudin protein family. The encoded protein is localized to the ER and the plasma membrane. In dogs, transcripts of this gene exist at high levels in the brain. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...