MLLT11 (NM_006818) Human Tagged ORF Clone
CAT#: RC205165
- TrueORF®
MLLT11 (Myc-DDK-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 11 (MLLT11)
ORF Plasmid: tGFP
"NM_006818" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AF1Q |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205165 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGGGACCCTGTGAGTAGCCAGTACAGTTCCTTTCTTTTCTGGAGGATGCCCATCCCAGAACTGGATC TGTCGGAGCTGGAAGGCCTGGGTCTGTCAGATACAGCCACCTACAAGGTCAAAGACAGCAGCGTTGGCAA AATGATCGGGCAAGCAACTGCAGCAGACCAGGAGAAAAACCCTGAAGGTGATGGCCTCCTTGAGTACAGC ACCTTCAACTTCTGGAGAGCTCCCATTGCCAGCATCCACTCCTTCGAACTGGACTTGCTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205165 protein sequence
Red=Cloning site Green=Tags(s) MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYS TFNFWRAPIASIHSFELDLL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_006818 |
ORF Size | 270 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006818.4 |
RefSeq Size | 2180 bp |
RefSeq ORF | 273 bp |
Locus ID | 10962 |
UniProt ID | Q13015 |
MW | 10.1 kDa |
Gene Summary | The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205165L1 | Lenti ORF clone of Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 (MLLT11), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC205165L2 | Lenti ORF clone of Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 (MLLT11), mGFP tagged |
CNY 5,890.00 |
|
RC205165L3 | Lenti ORF clone of Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 (MLLT11), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC205165L4 | Lenti ORF clone of Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 (MLLT11), mGFP tagged |
CNY 5,890.00 |
|
RG205165 | MLLT11 (tGFP-tagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 (MLLT11) |
CNY 2,800.00 |
|
SC115871 | MLLT11 (untagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 11 (MLLT11) |
CNY 1,200.00 |