SLIRP (NM_031210) Human Tagged ORF Clone
CAT#: RC205002
SLIRP (Myc-DDK-tagged)-Human chromosome 14 open reading frame 156 (C14orf156)
ORF Plasmid: tGFP
"NM_031210" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C14orf156; DC50; PD04872 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205002 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGCCTCAGCAGCGCGAGGTGCTGCGGCGCTGCGTAGAAGTATCAATCAGCCGGTTGCTTTTGTGA GAAGAATTCCTTGGACTGCGGCGTCGAGTCAGCTGAAAGAACACTTTGCACAGTTCGGCCATGTCAGAAG GTGCATTTTACCTTTTGACAAGGAGACTGGCTTTCACAGAGGTTTGGGTTGGGTTCAGTTTTCTTCAGAA GAAGGACTTCGGAATGCACTACAACAGGAAAATCATATTATAGATGGAGTAAAGGTCCAGGTTCACACTA GAAGGCCAAAACTTCCGCAAACATCTGATGATGAAAAGAAAGATTTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205002 protein sequence
Red=Cloning site Green=Tags(s) MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSE EGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_031210 |
ORF Size | 327 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_031210.3, NP_112487.1 |
RefSeq Size | 420 bp |
RefSeq ORF | 330 bp |
Locus ID | 81892 |
UniProt ID | Q9GZT3 |
Domains | RRM |
MW | 12.3 kDa |
Gene Summary | Steroid receptor RNA activator (SRA, or SRA1; MIM 603819) is a complex RNA molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. SLIRP interacts with stem-loop structure-7 of SRA (STR7) and modulates nuclear receptor transactivation (Hatchell et al., 2006 [PubMed 16762838]).[supplied by OMIM, Mar 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Interaction between androgen receptor and coregulator SLIRP is regulated by Ack1 tyrosine kinase and androgen
,De Silva, D;Zhang, Z;Liu, Y;Parker, JS;Xu, C;Cai, L;Wang, GG;Earp, HS;Whang, YE;,
Sci Rep
,PubMed ID 31819114
[SLIRP]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205002L1 | Lenti ORF clone of Human chromosome 14 open reading frame 156 (C14orf156), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC205002L2 | Lenti ORF clone of Human chromosome 14 open reading frame 156 (C14orf156), mGFP tagged |
CNY 5,890.00 |
|
RC205002L3 | Lenti ORF clone of Human chromosome 14 open reading frame 156 (C14orf156), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC205002L4 | Lenti ORF clone of Human chromosome 14 open reading frame 156 (C14orf156), mGFP tagged |
CNY 5,890.00 |
|
RG205002 | SLIRP (tGFP-tagged) - Human chromosome 14 open reading frame 156 (C14orf156) |
CNY 2,800.00 |
|
SC108657 | SLIRP (untagged)-Human chromosome 14 open reading frame 156 (C14orf156) |
CNY 1,200.00 |