HOXD4 (NM_014621) Human Tagged ORF Clone

CAT#: RC204747

HOXD4 (Myc-DDK-tagged)-Human homeobox D4 (HOXD4)

ORF Plasmid: DDK tGFP



  "NM_014621" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


HOXD4 mouse monoclonal antibody,clone OTI1E9
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms HHO.C13; Hox-4.2; HOX-5.1; HOX4; HOX4B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204747 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCATGAGTTCGTATATGGTGAACTCCAAGTATGTGGACCCCAAGTTCCCTCCGTGCGAGGAGTATT
TGCAGGGCGGCTACCTAGGCGAGCAGGGCGCCGACTACTACGGCGGCGGCGCGCAGGGCGCAGACTTCCA
GCCCCCGGGGCTCTACCCACGGCCCGACTTCGGTGAGCAGCCTTTCGGAGGCAGCGGCCCCGGGCCTGGC
TCGGCGCTGCCTGCGCGGGGTCACGGACAAGAGCCAGGCGGCCCCGGCGGTCACTACGCCGCTCCAGGAG
AGCCTTGCCCAGCTCCCCCGGCGCCTCCGCCGGCGCCCCTGCCTGGCGCCCGGGCCTACAGTCAGTCCGA
CCCCAAGCAGCCGCCCTCCGGGACGGCACTCAAGCAGCCGGCCGTGGTCTACCCCTGGATGAAGAAGGTG
CACGTGAATTCGGTGAACCCCAACTACACCGGTGGGGAACCCAAGCGGTCCCGAACGGCCTACACCCGGC
AGCAAGTCCTAGAACTGGAAAAAGAATTTCATTTTAACAGGTATCTGACAAGGCGCCGTCGGATTGAAAT
CGCTCACACCCTGTGTCTGTCGGAGCGCCAGATCAAGATCTGGTTCCAGAACCGGAGGATGAAGTGGAAA
AAAGATCATAAGCTGCCCAACACTAAAGGCAGGTCATCGTCCTCATCTTCCTCCTCATCTTGCTCCTCCT
CAGTCGCCCCCAGCCAGCATTTACAGCCGATGGCCAAAGACCACCACACGGACCTGACGACCTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204747 protein sequence
Red=Cloning site Green=Tags(s)

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPG
SALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
HVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWK
KDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014621
ORF Size 765 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014621.3
RefSeq Size 1298 bp
RefSeq ORF 768 bp
Locus ID 3233
UniProt ID P09016
Domains homeobox
Protein Families Transcription Factors
MW 27.9 kDa
Gene Summary This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...