GSTA3 (NM_000847) Human Tagged ORF Clone
CAT#: RC204624
GSTA3 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 3 (GSTA3)
ORF Plasmid: tGFP
"NM_000847" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | GSTA3-3; GTA3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204624 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGGGAAGCCCAAGCTTCACTACTTCAATGGACGGGGCAGAATGGAGCCCATCCGGTGGCTCTTGG CTGCAGCTGGAGTGGAGTTTGAAGAGAAATTTATAGGATCTGCAGAAGATTTGGGAAAGTTAAGAAATGA TGGGAGTTTGATGTTCCAGCAAGTACCAATGGTTGAGATTGATGGGATTAAGTTGGTACAGACCAGAGCC ATTCTCAACTACATTGCCAGCAAATACAACCTCTACGGGAAAGACATAAAGGAGAGAGCCCTAATTGATA TGTATACAGAAGGTATGGCAGATTTGAATGAAATGATCCTTCTTCTGCCCTTATGTCGACCTGAGGAAAA AGATGCCAAGATTGCCTTGATCAAAGAGAAAACAAAAAGTCGCTATTTCCCTGCCTTCGAAAAAGTGTTA CAGAGCCATGGACAAGACTACCTTGTTGGCAACAAGCTGAGCCGGGCTGACATTAGCCTGGTGGAACTTC TCTACTATGTGGAAGAGCTTGACTCCAGCCTTATCTCCAACTTCCCTCTGCTGAAGGCCCTGAAAACCAG AATCAGCAACCTGCCCACGGTGAAGAAGTTTCTACAGCCTGGCAGCCCAAGGAAGCCTCCCGCAGATGCA AAAGCTTTAGAAGAAGCCAGAAAGATTTTCAGGTTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC204624 protein sequence
Red=Cloning site Green=Tags(s) MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRA ILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVL QSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADA KALEEARKIFRF myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_000847 |
ORF Size | 666 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000847.2 |
RefSeq Size | 915 bp |
RefSeq ORF | 669 bp |
Locus ID | 2940 |
UniProt ID | Q16772 |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
MW | 25.3 kDa |
Gene Summary | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Simulation of interindividual differences in inactivation of reactive para-benzoquinone imine metabolites of diclofenac by glutathione S-transferases in human liver cytosol
,den Braver, MW;Zhang, Y;Venkataraman, H;Vermeulen, NP;Commandeur, JN;,
Toxicol. Lett.
,PubMed ID 27183920
[GSTA3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204624L1 | Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC204624L2 | Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged |
CNY 5,890.00 |
|
RC204624L3 | Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC204624L4 | Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged |
CNY 5,890.00 |
|
RG204624 | GSTA3 (tGFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3) |
CNY 5,200.00 |
|
SC122577 | GSTA3 (untagged)-Human glutathione S-transferase alpha 3 (GSTA3) |
CNY 3,600.00 |