MSMB (NM_002443) Human Tagged ORF Clone
CAT#: RC202704
MSMB (Myc-DDK-tagged)-Human microseminoprotein, beta- (MSMB), transcript variant PSP94
ORF Plasmid: tGFP
"NM_002443" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HPC13; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP-94; PSP57; PSP94 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202704 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAATGTTCTCCTGGGCAGCGTTGTGATCTTTGCCACCTTCGTGACTTTATGCAATGCATCATGCTATT TCATACCTAATGAGGGAGTTCCAGGAGATTCAACCAGGAAATGCATGGATCTCAAAGGAAACAAACACCC AATAAACTCGGAGTGGCAGACTGACAACTGTGAGACATGCACTTGCTACGAAACAGAAATTTCATGTTGC ACCCTTGTTTCTACACCTGTGGGTTATGACAAAGACAACTGCCAAAGAATCTTCAAGAAGGAGGACTGCA AGTATATCGTGGTGGAGAAGAAGGACCCAAAAAAGACCTGTTCTGTCAGTGAATGGATAATC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202704 protein sequence
Red=Cloning site Green=Tags(s) MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCC TLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002443 |
ORF Size | 342 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_002443.4 |
RefSeq Size | 503 bp |
RefSeq ORF | 345 bp |
Locus ID | 4477 |
UniProt ID | P08118 |
Protein Families | Secreted Protein, Transmembrane |
MW | 12.9 kDa |
Gene Summary | The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202704L1 | Lenti ORF clone of Human microseminoprotein, beta- (MSMB), transcript variant PSP94, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202704L2 | Lenti ORF clone of Human microseminoprotein, beta- (MSMB), transcript variant PSP94, mGFP tagged |
CNY 5,890.00 |
|
RC202704L3 | Lenti ORF clone of Human microseminoprotein, beta- (MSMB), transcript variant PSP94, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC202704L4 | Lenti ORF clone of Human microseminoprotein, beta- (MSMB), transcript variant PSP94, mGFP tagged |
CNY 5,890.00 |
|
RG202704 | MSMB (tGFP-tagged) - Human microseminoprotein, beta- (MSMB), transcript variant PSP94 |
CNY 2,800.00 |
|
SC111654 | MSMB (untagged)-Human microseminoprotein, beta- (MSMB), transcript variant PSP94 |
CNY 1,200.00 |