PIN1 (NM_006221) Human Tagged ORF Clone
CAT#: RC202543
PIN1 (Myc-DDK-tagged)-Human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1)
ORF Plasmid: tGFP
"NM_006221" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DOD; UBL5 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202543 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGACGAGGAGAAGCTGCCGCCCGGCTGGGAGAAGCGCATGAGCCGCAGCTCAGGCCGAGTGTACT ACTTCAACCACATCACTAACGCCAGCCAGTGGGAGCGGCCCAGCGGCAACAGCAGCAGTGGTGGCAAAAA CGGGCAGGGGGAGCCTGCCAGGGTCCGCTGCTCGCACCTGCTGGTGAAGCACAGCCAGTCACGGCGGCCC TCGTCCTGGCGGCAGGAGAAGATCACCCGGACCAAGGAGGAGGCCCTGGAGCTGATCAACGGCTACATCC AGAAGATCAAGTCGGGAGAGGAGGACTTTGAGTCTCTGGCCTCACAGTTCAGCGACTGCAGCTCAGCCAA GGCCAGGGGAGACCTGGGTGCCTTCAGCAGAGGTCAGATGCAGAAGCCATTTGAAGACGCCTCGTTTGCG CTGCGGACGGGGGAGATGAGCGGGCCCGTGTTCACGGATTCCGGCATCCACATCATCCTCCGCACTGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202543 protein sequence
Red=Cloning site Green=Tags(s) MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA LRTGEMSGPVFTDSGIHIILRTE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006221 |
ORF Size | 489 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_006221.4 |
RefSeq Size | 1138 bp |
RefSeq ORF | 492 bp |
Locus ID | 5300 |
UniProt ID | Q13526 |
Domains | Rotamase, WW |
Protein Families | Druggable Genome |
Protein Pathways | RIG-I-like receptor signaling pathway |
MW | 18.2 kDa |
Gene Summary | Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
RDH10 and ATRA sensitize triple-negative breast cancer to taxane-based chemotherapy through regulation of PIN1
,Grainger, J;Zhang, L;Yu, J;Vedell, P;Thompson, K;Kalari, K;Suman, V;Boughey, J;Goetz, M;Wang, L;,
Research Square
[PIN1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202543L1 | Lenti ORF clone of Human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202543L2 | Lenti ORF clone of Human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1), mGFP tagged |
CNY 5,890.00 |
|
RC202543L3 | Lenti ORF clone of Human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202543L4 | Lenti ORF clone of Human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1), mGFP tagged |
CNY 3,600.00 |
|
RG202543 | PIN1 (tGFP-tagged) - Human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1) |
CNY 2,800.00 |
|
SC116229 | PIN1 (untagged)-Human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1) |
CNY 1,200.00 |