H2BC5 (NM_138720) Human Tagged ORF Clone
CAT#: RC201189
HIST1H2BD (Myc-DDK-tagged)-Human histone cluster 1, H2bd (HIST1H2BD), transcript variant 2
ORF Plasmid: tGFP
"NM_138720" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | dJ221C16.6; H2B.1B; H2B/a; H2B/b; H2B/g; H2B/h; H2B/k; H2B/l; H2BFA; H2BFB; H2BFG; H2BFH; H2BFK; H2BFL; HIRIP2; HIST1H2BC; HIST1H2BD; HIST1H2BE; HIST1H2BF; HIST1H2BG; HIST1H2BI |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201189 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCTGAACCTACCAAGTCTGCTCCTGCCCCAAAGAAGGGCTCCAAGAAGGCGGTGACTAAGGCTCAGA AGAAGGACGGGAAGAAGCGCAAGCGCAGCCGCAAGGAGAGCTATTCAGTGTATGTGTACAAGGTGCTGAA GCAGGTCCATCCCGACACCGGCATCTCTTCCAAGGCAATGGGGATCATGAATTCCTTCGTCAACGACATC TTCGAGCGCATCGCAGGCGAGGCTTCCCGCCTGGCGCATTACAACAAGCGCTCGACCATCACCTCCAGGG AGATCCAGACGGCCGTGCGCCTGCTGCTTCCGGGGGAGCTGGCCAAGCACGCCGTGTCGGAGGGCACCAA GGCCGTCACCAAGTACACCAGTTCCAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201189 protein sequence
Red=Cloning site Green=Tags(s) MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_138720 |
ORF Size | 378 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_138720.2 |
RefSeq Size | 824 bp |
RefSeq ORF | 381 bp |
Locus ID | 3017 |
UniProt ID | P58876 |
Protein Pathways | Systemic lupus erythematosus |
MW | 13.9 kDa |
Gene Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Two transcripts that encode the same protein have been identified for this gene, which is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201189L3 | Lenti ORF clone of Human histone cluster 1, H2bd (HIST1H2BD), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC201189L4 | Lenti ORF clone of Human histone cluster 1, H2bd (HIST1H2BD), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG201189 | HIST1H2BD (tGFP-tagged) - Human histone cluster 1, H2bd (HIST1H2BD), transcript variant 2 |
CNY 4,370.00 |
|
SC309501 | HIST1H2BD (untagged)-Human histone cluster 1, H2bd (HIST1H2BD), transcript variant 2 |
CNY 1,800.00 |