PSMA7 (NM_002792) Human Tagged ORF Clone
CAT#: RC201169
PSMA7 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7)
ORF Plasmid: tGFP
"NM_002792" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C6; HEL-S-276; HSPC; RC6-1; XAPC7 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201169 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCTACGACCGCGCCATCACCGTCTTCTCGCCCGACGGCCACCTCTTCCAAGTGGAGTACGCGCAGG AGGCCGTCAAGAAGGGCTCGACCGCGGTTGGTGTTCGAGGAAGAGACATTGTTGTTCTTGGTGTGGAGAA GAAGTCAGTGGCCAAACTGCAGGATGAAAGAACAGTGCGGAAGATCTGTGCTTTGGATGACAACGTCTGC ATGGCCTTTGCAGGCCTCACCGCCGATGCAAGGATAGTCATCAACAGGGCCCGGGTGGAGTGCCAGAGCC ACCGGCTGACTGTGGAGGACCCGGTCACTGTGGAGTACATCACCCGCTACATCGCCAGTCTGAAGCAGCG TTATACGCAGAGCAATGGGCGCAGGCCGTTTGGCATCTCTGCCCTCATCGTGGGTTTCGACTTTGATGGC ACTCCTAGGCTCTATCAGACTGACCCCTCGGGCACATACCATGCCTGGAAGGCCAATGCCATAGGCCGGG GTGCCAAGTCAGTGCGTGAGTTCCTGGAGAAGAACTATACTGACGAAGCCATTGAAACAGATGATCTGAC CATTAAGCTGGTGATCAAGGCACTCCTGGAAGTGGTTCAGTCAGGTGGCAAAAACATTGAACTTGCTGTC ATGAGGCGAGATCAATCCCTCAAGATTTTAAATCCTGAAGAAATTGAGAAGTATGTTGCTGAAATTGAAA AAGAAAAAGAAGAAAACGAAAAGAAGAAACAAAAGAAAGCATCA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201169 protein sequence
Red=Cloning site Green=Tags(s) MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002792 |
ORF Size | 744 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002792.4 |
RefSeq Size | 1050 bp |
RefSeq ORF | 747 bp |
Locus ID | 5688 |
UniProt ID | O14818 |
Domains | proteasome |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
MW | 27.9 kDa |
Gene Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9. [provided by RefSeq, Jul 2012] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Novel protein complexes containing autophagy and UPS components regulate proteasome-dependent PARK2 recruitment onto mitochondria and PARK2-PARK6 activity during mitophagy
,null,
Cell Death & Disease
,PubMed ID 36357363
[PSMA7]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201169L1 | Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC201169L2 | Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), mGFP tagged |
CNY 5,890.00 |
|
RC201169L3 | Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC201169L4 | Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), mGFP tagged |
CNY 6,000.00 |
|
RG201169 | PSMA7 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7) |
CNY 5,200.00 |
|
SC319465 | PSMA7 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7) |
CNY 3,600.00 |