FKBP1B (NM_054033) Human Tagged ORF Clone
CAT#: RC200667
FKBP1B (Myc-DDK-tagged)-Human FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2
ORF Plasmid: tGFP
"NM_054033" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | FKBP1L; FKBP12.6; OTK4; PKBP1L; PPIase |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200667 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGCGTGGAGATCGAGACCATCTCCCCCGGAGACGGAAGGACATTCCCCAAGAAGGGCCAAACGTGTG TGGTGCACTACACAGGAATGCTCCAAAATGGGAAGAAGTTTGATTCATCCAGAGACAGAAACAAACCTTT CAAGTTCAGAATTGGCAAACAGGAAGTCATCAAAGGTTTTGAAGAGGGTGCAGCCCAGCTGGGTCCTCTT TCTCCTCTCCCCATCTGCCCCCATCCCTGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200667 protein sequence
Red=Cloning site Green=Tags(s) MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPL SPLPICPHPC myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_054033 |
ORF Size | 240 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_054033.4 |
RefSeq Size | 1016 bp |
RefSeq ORF | 243 bp |
Locus ID | 2281 |
UniProt ID | P68106 |
Domains | FKBP |
Protein Families | Druggable Genome |
MW | 8.8 kDa |
Gene Summary | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Transcriptional epigenetic regulation of Fkbp1 / Pax9 genes is associated with impaired sensitivity to platinum treatment in ovarian cancer
,null,
Clinical Epigenetics
,PubMed ID 34454589
[FKBP1B]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200667L3 | Lenti ORF clone of Human FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC200667L4 | Lenti ORF clone of Human FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG200667 | FKBP1B (tGFP-tagged) - Human FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2 |
CNY 2,800.00 |
|
SC320205 | FKBP1B (untagged)-Human FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2 |
CNY 1,200.00 |