GNG5 (NM_005274) Human Tagged ORF Clone
CAT#: RC200572
GNG5 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5)
ORF Plasmid: tGFP
"NM_005274" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200572 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTGGCTCCTCCAGCGTCGCCGCTATGAAGAAAGTGGTTCAACAGCTCCGGCTGGAGGCCGGACTCA ACCGCGTAAAAGTTTCCCAGGCAGCTGCAGACTTGAAACAGTTCTGTCTGCAGAATGCTCAACATGACCC TCTGCTGACTGGAGTATCTTCAAGTACAAATCCCTTCAGACCCCAGAAAGTCTGTTCCTTTTTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200572 protein sequence
Red=Cloning site Green=Tags(s) MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005274 |
ORF Size | 204 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005274.3 |
RefSeq Size | 823 bp |
RefSeq ORF | 207 bp |
Locus ID | 2787 |
UniProt ID | P63218 |
Domains | G-gamma |
Protein Pathways | Chemokine signaling pathway |
MW | 7.3 kDa |
Gene Summary | G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327]; summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200572L3 | Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC200572L4 | Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5), mGFP tagged |
CNY 3,600.00 |
|
RG200572 | GNG5 (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5) |
CNY 2,800.00 |
|
SC116833 | GNG5 (untagged)-Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5) |
CNY 1,200.00 |