DGCR6L (NM_033257) Human Tagged ORF Clone

CAT#: RC200317

DGCR6L (Myc-DDK-tagged)-Human DiGeorge syndrome critical region gene 6-like (DGCR6L)

ORF Plasmid: DDK tGFP



  "NM_033257" in other vectors (7)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


DGCR6L rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms DGCR6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200317 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGCTACGCGGCCGCCTTGGAGGAGGTGGCGGACGGTGCCCGGCAGCAGGAGCGACACTACCAGT
TGCTGTCGGCGCTACAGAGCCTGGTGAAGGAGTTGCCCAGCTCTTTCCAGCAGCGCCTGTCCTACACCAC
GCTCAGCGACCTGGCCCTGGCGCTTCTCGACGGCACCGTGTTCGAAATCGTGCAGGGGCTACTGGAGATC
CAGCACCTCACCGAAAAGAGCCTGTACAACCAGCGCCTGCGCCTACAGAACGAGCACCGAGTGCTCAGGC
AGGCGCTGCGGCAGAAGCACCAGGAAGCCCAGCAGGCCTGCCGGCCCCACAACCTGCCTGTGGTTCAGGC
GGCTCAGCAGCGAGAACTAGAGGCCGTGGAACACCGGATCCGTGAGGAGCAGCGGGCGATGGACCAGAAG
ATCATCCTGGAGCTGGACCGGAAGGTGGCTGACCAGCAGAGCACACTGGAGAAGGCGGGGGTGGCTGGCT
TCTACGTGACCACCAACCCACAGGAGCTGATGCTGCAGATGAACCTGCTGGAACTCATCCGAAAGCTGCA
GCAGAGGGGCTGCCGGGCAGGGAATGCAGCCCTGGGACTGGGAGGTCCCTGGCAGTCGCCTGCTGCCCAG
TGTGACCAGAAAGGCAGCCCTGTCCCACCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200317 protein sequence
Red=Cloning site Green=Tags(s)

MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI
QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK
IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ
CDQKGSPVPP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_033257
ORF Size 660 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_033257.4
RefSeq Size 1217 bp
RefSeq ORF 663 bp
Locus ID 85359
UniProt ID Q9BY27
Protein Families Druggable Genome, Transcription Factors
MW 24.9 kDa
Gene Summary This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...