Lpar1 (NM_001290486) Mouse Tagged ORF Clone

CAT#: MR229393

  • TrueORF®

Lpar1 (myc-DDK-tagged) - Mouse lysophosphatidic acid receptor 1 (Lpar1), transcript variant 3



  "NM_001290486" in other vectors (1)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,420.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AI326300; Edg2; Gpcr26; Kdt2; lpA1; vzg-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR229393 representing NM_001290486
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGAACAACAGTGCTTCTACAATGAGTCTATCGCCTTCTTTTATAACCGGAGTGGGAAATATCTAG
CCACAGAATGGAACACAGTGAGCAAGCTGGTGATGGGACTGGGCATCACTGTTTGCGTGTTCATCATGTT
GGCCAATCTCCTGGTCATGGTGGCAATCTACGTCAACCGCCGCTTCCATTTCCCTATTTATTACTTGATG
GCCAACCTGGCTGCTGCAGACTTCTTCGCTGGATTGGCCTACTTCTACCTGATGTTCAATACAGGACCTA
ATACCCGGAGACTGACTGTTAGCACGTGGCTCCTCCGGCAGGGCCTCATTGACACCAGCCTGACAGCTTC
TGTGGCCAACCTGCTGGCTATTGCTATCGAGAGGCACATCACGGTTTTCCGCATGCAGCTCCATACACGA
ATGAGCAACCGGCGCGTGGTGGTGGTGATTGTAGTCATCTGGACTATGGCCATTGTGATGGGTGCTATAC
CCAGTGTGGGCTGGAACTGCATCTGTGATATCGATCACTGTTCCAACATGGCACCCCTCTACAGTGACTC
CTACTTAGTCTTCTGGGCCATTTTCAACCTGGTGACCTTTGTGGTCATGGTGGTTCTCTACGCTCACATC
TTTGGCTATGTTCGCCAGAGGACTATGAGGATGTCTCGGCATAGTTCTGGACCCAGGAGGAATCGGGACA
CCATGATGAGCCTTCTGAAGACTGTGGTCATTGTGCTTGGTGCCTTTATTGTCTGCTGGACTCCGGGATT
GGTCTTGTTATTGCTGGATGTGTGCTGCCCGCAGTGCGATGTCCTGGCCTATGAGAAGTTCTTCCTCCTC
CTGGCCGAGTTCAACTCTGCTATGAACCCCATCATCTACTCCTACCGCGACAAAGAGATGAGCGCCACCT
TCAGGCAGATCCTGTGTTGCCAGCGCAACGAGAACCCTAATGGCCCCACGGAAGGCTCTGACCGCTCTGC
CTCCTCCCTCAACCACACCATTCTGGCTGGAGTTCACAGCAACGACCACTCTGTGGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR229393 representing NM_001290486
Red=Cloning site Green=Tags(s)

MNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLVMVAIYVNRRFHFPIYYLM
ANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTR
MSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHI
FGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLL
LAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSNDHSVV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001290486
ORF Size 1038 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001290486.1, NP_001277415.1
RefSeq Size 3247 bp
RefSeq ORF 1041 bp
Locus ID 14745
UniProt ID P61793
MW 39.8 kDa
Gene Summary Receptor for lysophosphatidic acid (LPA) (PubMed:11087877, PubMed:18066075). Plays a role in the reorganization of the actin cytoskeleton, cell migration, differentiation and proliferation, and thereby contributes to the responses to tissue damage and infectious agents. Activates downstream signaling cascades via the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins (PubMed:8922387, PubMed:9600933, PubMed:11040035, PubMed:18157949, PubMed:18066075, PubMed:23478264). Signaling inhibits adenylyl cyclase activity and decreases cellular cAMP levels (PubMed:11040035, PubMed:12215548). Signaling triggers an increase of cytoplasmic Ca(2+) levels (PubMed:12215548). Activates RALA; this leads to the activation of phospholipase C (PLC) and the formation of inositol 1,4,5-trisphosphate (PubMed:11040035, PubMed:12215548, PubMed:23478264). Signaling mediates activation of down-stream MAP kinases (PubMed:11040035). Contributes to the regulation of cell shape (PubMed:8922387, PubMed:9600933, PubMed:11040035, PubMed:11087877). Promotes Rho-dependent reorganization of the actin cytoskeleton in neuronal cells and neurite retraction (PubMed:9600933, PubMed:11040035, PubMed:12181339). Promotes the activation of Rho and the formation of actin stress fibers (PubMed:9600933, PubMed:12215548). Promotes formation of lamellipodia at the leading edge of migrating cells via activation of RAC1 (PubMed:23478264). Through its function as lysophosphatidic acid receptor, plays a role in chemotaxis and cell migration, including responses to injury and wounding (PubMed:11087877, PubMed:18066075, PubMed:23478264). Plays a role in triggering inflammation in response to bacterial lipopolysaccharide (LPS) via its interaction with CD14 (PubMed:21821728). Promotes cell proliferation in response to lysophosphatidic acid (PubMed:9600933, PubMed:11087877, PubMed:12215548, PubMed:18157949, PubMed:17692995, PubMed:23478264). Required for normal skeleton development (PubMed:21569876). May play a role in osteoblast differentiation (PubMed:21569876). Required for normal brain development (PubMed:17656621, PubMed:18708146). Required for normal proliferation, survival and maturation of newly formed neurons in the adult dentate gyrus (PubMed:18708146). Plays a role in pain perception and in the initiation of neuropathic pain (PubMed:15195086, PubMed:19689455).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...