Akt1s1 (NM_001253920) Mouse Tagged ORF Clone

CAT#: MR228834

  • TrueORF®

Akt1s1 (myc-DDK-tagged) - Mouse AKT1 substrate 1 (proline-rich) (Akt1s1), transcript variant 1



  "NM_001253920" in other vectors (1)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 3,810.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1110012J22Rik; AI227026; Lobe; Lobel; PRAS40
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR228834 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCTGGGCGGCCAGAGGAACTGTGGGAAGCCGTCGTGGGGGCCGCCGAGCGCTTTCAGGCCCGCA
CTGGCACAGAGCTGGTATTACTGACTGCAGCGCCACCGCCGCCGCCCCGCCCTGGACCCTGTGCCTATGC
CGCCCATGGCCGCGGAGCCCTGGCAGAGGCGGCCCGACGCTGCCTCCACGACATCGCACAGGCGCACAGG
GCTGCCACTGCCACCCGACCTCCTGGTCCCCCACCAGCACCACAGCCGCCCAGCCCTGCTCCTAGTCCAC
CACCTCGGCCAGCCCTGGCCAGGGAGGATGAGGAGGAAGATGAGGACGAGCCCACTGAAACAGAGACATC
TGGGGAGCGGCTGGGCGGTAGCGATAATGGAGGTCTCTTCATGATGGATGAGGATGCCACCCTCCAGGAC
CTGCCCCCCTTCTGCGAGTCAGACCCGGAGAGCACAGACGACGGCAGCCTGAGCGAGGAGACGCCCGCCG
GTCCCACAGCCTGTCCCCAGCCCCCGGCCACAGCCCTGCCTACCCAGCAGTATGCCAAGTCTCTGCCCGT
GTCGGTGCCAGTGTGGGCCTTCAAGGAGAAGAGGACAGAAGCCCGATCGTCAGATGAGGAGAATGGCCCG
CCCTCCTCGCCCGACCTAGACCGAATAGCGGCCAGCATGCGCGCGCTGGTGCTGCGGGAGGCTGAGGACA
CCCAGGTCTTCGGGGATCTTCCGCGGCCGCGGCTCAATACCAGCGACTTCCAGAAGCTGAAGCGGAAATA
T


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR228834 protein sequence
Red=Cloning site Green=Tags(s)

MASGRPEELWEAVVGAAERFQARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIAQAHR
AATATRPPGPPPAPQPPSPAPSPPPRPALAREDEEEDEDEPTETETSGERLGGSDNGGLFMMDEDATLQD
LPPFCESDPESTDDGSLSEETPAGPTACPQPPATALPTQQYAKSLPVSVPVWAFKEKRTEARSSDEENGP
PSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001253920
ORF Size 774 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001253920.1, NP_001240849.1
RefSeq Size 1775 bp
RefSeq ORF 774 bp
Locus ID 67605
UniProt ID Q9D1F4
MW 27.5 kDa
Gene Summary Subunit of mTORC1, which regulates cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. Within mTORC1, AKT1S1 negatively regulates mTOR activity in a manner that is dependent on its phosphorylation state and binding to 14-3-3. Inhibits RHEB-GTP-dependent mTORC1 activation. Substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. May also play a role in nerve growth factor-mediated neuroprotection.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...