Rgr (NM_001301692) Mouse Tagged ORF Clone

CAT#: MR228342

  • TrueORF®

Rgr (myc-DDK-tagged) - Mouse retinal G protein coupled receptor (Rgr), transcript variant 2



  "NM_001301692" in other vectors (1)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1,900.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


RGR Antibody - middle region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR228342 representing NM_001301692
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCTTGTTGCAGCGGTATCCAGCCTCCTCCGGCAGACAGTTGGCATGGGACACGGCCATCCCTCTGG
TGCTGTTTGTGTGGATGTCATCTGCCTTCTGGGCATCCCTGCCCCTGATGGGCTGGGGCCACTATGACTA
TGAGCCTGTGGGGACATGCTGTACACTGGACTATTCGAGGGGTGACAGAAACTTCATCAGTTTTCTCTTC
ACCATGGCTTTTTTCAACTTCCTCGTACCCCTGTTCATCACACACACTTCATACCGGTTCATGGAGCAGA
AATTCTCCAGGAGTGGCCATCTCCCGGTGAATACTACTCTTCCAGGCAGAATGCTGCTGCTTGGCTGGGG
CCCCTATGCCCTCCTGTACCTATACGCAGCCATCGCAGATGTGAGCTTCATCTCTCCTAAACTACAGATG
GTGCCTGCTCTCATCGCCAAAACCATGCCCACAATCAACGCCATCAACTATGCGTTGCACAGGGAGATGG
TCTGTAGAGGAACCTGGCAGTGTCTGTCTCCACAAAAAAGCAAGAAGGACCGAACCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR228342 representing NM_001301692
Red=Cloning site Green=Tags(s)

MPLLQRYPASSGRQLAWDTAIPLVLFVWMSSAFWASLPLMGWGHYDYEPVGTCCTLDYSRGDRNFISFLF
TMAFFNFLVPLFITHTSYRFMEQKFSRSGHLPVNTTLPGRMLLLGWGPYALLYLYAAIADVSFISPKLQM
VPALIAKTMPTINAINYALHREMVCRGTWQCLSPQKSKKDRTQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001301692
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001301692.1, NP_001288621.1
RefSeq Size 4185 bp
RefSeq ORF 552 bp
Locus ID 57811
MW 21.4 kDa
Gene Summary The gene is a member of the opsin family of G-protein coupled receptors. The encoded protein is expressed in the retina, and acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal. Disruption of a similar gene in human is associated with autosomal recessive (arRP) and autosomal dominant retinitis pigmentosa (adRP). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...