Lrat (NM_023624) Mouse Tagged ORF Clone

CAT#: MR225686

  • TrueORF®

Lrat (Myc-DDK-tagged) - Mouse lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase) (Lrat)

ORF Plasmid: DDK tGFP



  "NM_023624" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,081.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1300010A18Rik; AI449251
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR225686 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGAACCCAATGCTGGAAGCTGCGTCCCTCCTCCTGGAGAAACTGCTCCTTATTTCCAACTTCAAGC
TCTTTAGCGTGAGCGTCCCGGGAGGAGGCACAGGGAAGAACCGTCCCTATGAAATCAGCTCTTTCGTCCG
GGGCGACGTGTTGGAGGTGTCACGGACCCATTTTATCCACTATGGGATCTACCTGGGGGAAAACCGTGTC
GCCCATCTAATGCCTGACATCCTGTTGGCCCTGACCAATGACAAGGAACGCACTCAGAAGGTGGTCTCCA
ACAAGCGTCTCCTCCTGGGAGTCATTTGCAAGGTGGCTAGCATCCGTGTGGACACAGTAGAGGACTTTGC
CTACGGAGCAGACATCCTAGTCAATCACCTAGACGGGACTCTCAAGAAGAAGTCCTTACTCAATGAGGAG
GTGGCACGCAGAGCTGAGCAGCAGTTGGGACTGACTCCATACAGCCTACTGTGGAACAACTGCGAACACT
TTGTGACTTACTGCAGATATGGCTCTCGGATCAGTCCACAGGCTGAGAAGTTCTATGACACCGTGAAGAT
AATCATTCGTGATCAGAGAAGCAGTCTTGCTTCGGCTGTCTTGGGATTAGCATCTATTGTCTACACAGGC
CTGGCATCATATATGACCCTTCCTGCAATCTGTATCCCATTCTGCTTGTGGATGATGTCTGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR225686 protein sequence
Red=Cloning site Green=Tags(s)

MKNPMLEAASLLLEKLLLISNFKLFSVSVPGGGTGKNRPYEISSFVRGDVLEVSRTHFIHYGIYLGENRV
AHLMPDILLALTNDKERTQKVVSNKRLLLGVICKVASIRVDTVEDFAYGADILVNHLDGTLKKKSLLNEE
VARRAEQQLGLTPYSLLWNNCEHFVTYCRYGSRISPQAEKFYDTVKIIIRDQRSSLASAVLGLASIVYTG
LASYMTLPAICIPFCLWMMSG

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_023624
ORF Size 696 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_023624.4, NP_076113.1
RefSeq Size 5349 bp
RefSeq ORF 696 bp
Locus ID 79235
UniProt ID Q9JI60
MW 25.8 kDa
Gene Summary Transfers the acyl group from the sn-1 position of phosphatidylcholine to all-trans retinol, producing all-trans retinyl esters (By similarity). Retinyl esters are storage forms of vitamin A (By similarity). LRAT plays a critical role in vision (By similarity). It provides the all-trans retinyl ester substrates for the isomerohydrolase which processes the esters into 11-cis-retinol in the retinal pigment epithelium; due to a membrane-associated alcohol dehydrogenase, 11 cis-retinol is oxidized and converted into 11-cis-retinaldehyde which is the chromophore for rhodopsin and the cone photopigments (By similarity). Required for the survival of cone photoreceptors and correct rod photoreceptor cell morphology (PubMed:25416279).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...