Pdcd6 (NM_011051) Mouse Tagged ORF Clone
CAT#: MR222510
- TrueORF®
Pdcd6 (Myc-DDK-tagged) - Mouse programmed cell death 6 (Pdcd6)
ORF Plasmid: tGFP
"NM_011051" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 4,180.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | alg-2; Alg2; AV299538; MA-3; PS2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR222510 representing NM_011051
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTGCCTACTCCTACCGCCCAGGCCCGGGTGGTGGCCCCGGCCCTGCTGCTGGAGCTGCACTGCCAG ACCAGAGCTTCCTGTGGAACGTCTTCCAGCGGGTTGATAAAGACAGGAGTGGAGTGATTTCAGACAATGA GCTTCAGCAAGCATTATCCAATGGTACATGGACTCCATTTAACCCAGTGACTGTGAGGTCAATCATTTCT ATGTTTGACCGAGAAAACAAGGCTGGTGTGAACTTCAGTGAATTCACGGGTGTGTGGAAGTATATCACAG ACTGGCAGAATGTCTTCCGGACCTACGACAGGGACAACTCTGGGATGATTGACAAGAACGAGCTCAAACA AGCACTCTCAGGTTTTGGCTACCGGCTCTCTGATCAGTTCCATGACATCCTCATCCGAAAATTTGACAGG CAAGGACGGGGCCAGATCGCATTTGATGACTTCATCCAGGGCTGCATCGTCTTGCAGAGGTTGACAGACA TATTCAGACGCTATGACACGGATCAGGATGGCTGGATTCAGGTGTCTTATGAGCAATATCTCTCCATGGT CTTCAGCATTGTA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR222510 representing NM_011051
Red=Cloning site Green=Tags(s) MAAYSYRPGPGGGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIIS MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDR QGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_011051 |
ORF Size | 573 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_011051.3, NP_035181.1 |
RefSeq Size | 1524 bp |
RefSeq ORF | 576 bp |
Locus ID | 18570 |
UniProt ID | P12815 |
MW | 21.9 kDa |
Gene Summary | Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)-Golgi vesicular transport, endosomal biogenesis or membrane repair (PubMed:10744743, PubMed:11525164, PubMed:27541325). Acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium: calcium-binding triggers exposure of apolar surface, promoting interaction with different sets of proteins thanks to 3 different hydrophobic pockets, leading to translocation to membranes (PubMed:10744743, PubMed:11525164, PubMed:27541325). Involved in ER-Golgi transport by promoting the association between PDCD6IP and TSG101, thereby bridging together the ESCRT-III and ESCRT-I complexes (PubMed:10744743, PubMed:11525164, PubMed:27541325). Together with PEF1, acts as calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in ER-Golgi transport by regulating the size of COPII coats (By similarity). In response to cytosolic calcium increase, the heterodimer formed with PEF1 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification (By similarity). Involved in the regulation of the distribution and function of MCOLN1 in the endosomal pathway (By similarity). Promotes localization and polymerization of TFG at endoplasmic reticulum exit site (By similarity). Required for T-cell receptor-, Fas-, and glucocorticoid-induced apoptosis (PubMed:8560270). May mediate Ca(2+)-regulated signals along the death pathway: interaction with DAPK1 can accelerate apoptotic cell death by increasing caspase-3 activity (By similarity). Its role in apoptosis may however be indirect, as suggested by knockout experiments (PubMed:12024023). May inhibit KDR/VEGFR2-dependent angiogenesis; the function involves inhibition of VEGF-induced phosphorylation of the Akt signaling pathway (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC209157 | Pdcd6 (untagged) - Mouse programmed cell death 6 (Pdcd6), (10ug) |
CNY 3,990.00 |
|
MG222510 | Pdcd6 (tGFP-tagged) - Mouse programmed cell death 6 (Pdcd6), (10ug) |
CNY 5,200.00 |
|
MR222510L3 | Lenti ORF clone of Pdcd6 (Myc-DDK-tagged) - Mouse programmed cell death 6 (Pdcd6) |
CNY 5,890.00 |
|
MR222510L4 | Lenti ORF clone of Pdcd6 (mGFP-tagged) - Mouse programmed cell death 6 (Pdcd6) |
CNY 5,890.00 |