Hint2 (NM_026871) Mouse Tagged ORF Clone

CAT#: MR220622

  • TrueORF®

Hint2 (Myc-DDK-tagged) - Mouse histidine triad nucleotide binding protein 2 (Hint2), nuclear gene encoding mitochondrial protein

ORF Plasmid: DDK tGFP



  "NM_026871" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1,800.00

CNY 4,180.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Hint2 Antibody - middle region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1190005L05Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR220622 representing NM_026871
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCTGCTGTGCTGCTGGCCGTGGGCTTGCGCGCTGCGCGCAGAACCCTGGCTGCCGCGGGGGCCC
GGGGGGCGCAGGTCCGAGGAAACGCAGGGGTGTCCGACGGGAGTGAAGTGGCCAAGGCCCAGAAAGCAGC
TCCTGGAGGAGCATCGCCAACCATCTTCTCCCGGATTTTGGACCGGAGTCTCCCAGCTGACATTCTATAT
GAAGATCAGCAGTGCCTTGTGTTCCGTGACGTAGCTCCTCAGGCTCCTGTGCACTTTCTGGTCATTCCTA
GGAAGCCCATTCCTCGAATTAGCCAGGCTGAAGAGGACGACCAGCAGCTTCTAGGACACTTACTCCTTGT
GGCCAAGAAGATAGCACAGGCCCAGGGTCTGAAAGATGGGTATCGACTTGTGGTTAATGATGGCAAGATG
GGCGCACAGTCTGTGTATCACCTGCACATTCACGTACTTGGAGGCCGACAGCTGCAGTGGCCACCTGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR220622 representing NM_026871
Red=Cloning site Green=Tags(s)

MAAAVLLAVGLRAARRTLAAAGARGAQVRGNAGVSDGSEVAKAQKAAPGGASPTIFSRILDRSLPADILY
EDQQCLVFRDVAPQAPVHFLVIPRKPIPRISQAEEDDQQLLGHLLLVAKKIAQAQGLKDGYRLVVNDGKM
GAQSVYHLHIHVLGGRQLQWPPG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_026871
ORF Size 489 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_026871.1, NP_081147.1
RefSeq Size 636 bp
RefSeq ORF 492 bp
Locus ID 68917
UniProt ID Q9D0S9
MW 17.3 kDa
Gene Summary Hydrolase probably involved in steroid biosynthesis. May play a role in apoptosis. Has adenosine phosphoramidase activity (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...