Edn3 (NM_007903) Mouse Tagged ORF Clone

CAT#: MR220221

  • TrueORF®

Edn3 (Myc-DDK-tagged) - Mouse endothelin 3 (Edn3)

ORF Plasmid: DDK tGFP



  "NM_007903" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,600.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms ET-3; ls; PPET3; tmgc48
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR220221 representing NM_007903
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCGGGGCTGTGGCTCCTTCTCGGGCTCACAGTGACCTCCGCTGCAGGACTTGTGCCTTGCCCCC
AGTCTGGGGACTCTGGCAGAGCCAGTGTGTCCCAGGGTCCCCCTGAAGCTGGATCAGAGAGGGGCTGTGA
AGAGACTGTGGCTGGCCCTGGTGAGAGGATTGTGTCCCCAACAGTTGCACTGCCTGCACAGCCTGAAAGC
GCTGGGCAGGAACGGGCACCAGGCAGGTCTGGGAAACAAGAGGACAAGGGGCTGCCTGCACACCACCGCC
CTCGCCGCTGCACGTGCTTCACTTACAAGGACAAGGAGTGTGTCTACTATTGCCACCTGGACATCATCTG
GATTAACACTCCTGAACAGACTGTGCCCTATGGACTGTCCAACTACAGAGAAAGCCTTCGGGGAAAGAGG
TCCTTGGGGCCAGTTCCAGAAAGCTCCCAGCCTTCTCCGTGGACACGCTTGCGTTGTACTTGTATGGGGG
CGGATGACAAGGCCTGTGCACACTTCTGTGCACGCACCAGAGATGTCACCAGTTATTCCGGGAGAGCAGA
AAGGCCAGCTGCAGAAGAGATGCGGGAGACTGGAGGCCCACGTCAAAGGTTGATGTCAAGGACAGATAAA
GCCCACCGGCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR220221 representing NM_007903
Red=Cloning site Green=Tags(s)

MEPGLWLLLGLTVTSAAGLVPCPQSGDSGRASVSQGPPEAGSERGCEETVAGPGERIVSPTVALPAQPES
AGQERAPGRSGKQEDKGLPAHHRPRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRESLRGKR
SLGPVPESSQPSPWTRLRCTCMGADDKACAHFCARTRDVTSYSGRAERPAAEEMRETGGPRQRLMSRTDK
AHRP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007903
ORF Size 642 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_007903.5
RefSeq Size 2963 bp
RefSeq ORF 645 bp
Locus ID 13616
UniProt ID P48299
MW 23.8 kDa
Gene Summary This gene is a member of the endothelin family whose members encode proteins that act on G protein-coupled receptors. Endothelins are produced as large prepropolypeptide precursors that undergo a first cleavage by a subtilisin serine protease to form an inactive intermediate, which in turn is cleaved again by endothelin-converting enzyme 1 (ECE-1) to yield the active 21 amino acid peptide. This gene encodes a protein which is expressed in neural crest cells (NCC), binds to endothelin receptor b (Ednrb) and plays an essential role in the development of NCC-derived cell lineages including melanocytes and enteric neurons. Mutations in this gene are associated with terminal aganglionosis and white spotted coat in mice and Hirschsprung's disease and Waardenburg syndrome in humans. [provided by RefSeq, Apr 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...