Ncbp2 (NM_026554) Mouse Tagged ORF Clone
CAT#: MR219175
- TrueORF®
Ncbp2 (Myc-DDK-tagged) - Mouse nuclear cap binding protein subunit 2 (Ncbp2)
ORF Plasmid: tGFP
"NM_026554" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 20kDa; 5930413E18Rik; AA536802; AI843301; C79367 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR219175 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGGGTGGCTTACTGAAGGCGCTGCGCAGCGACTCCTACGTGGAACTCAGCGAGTACCGGGACCAGC ACTTTCGGGGCGACAATGAAGAACAAGAAAAGTTACTGAAGAAAAGCTGTACGTTGTATGTTGGAAATCT TTCCTTTTATACAACTGAAGAACAGATTTATGAACTCTTCAGCAAAAGTGGTGATATAAAGAAGATCATC ATGGGTCTGGATAAAATGAAGAAAACAGCATGTGGGTTCTGTTTTGTGGAATACTATTCAAGAGCAGATG CGGAGAACGCAATGCGGTACATAAACGGAACTCGTCTGGATGACCGGATCATACGGACAGACTGGGATGC AGGCTTTAAGGAGGGCAGGCAGTATGGACGTGGACGGTCTGGGGGTCAGGTTCGGGACGAGTATCGGGAG GACTACGATGCTGGAAGAGGCGGCTATGGGAAACTGGCACAAAAACAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR219175 protein sequence
Red=Cloning site Green=Tags(s) MSGGLLKALRSDSYVELSEYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKII MGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRE DYDAGRGGYGKLAQKQ myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_026554 |
ORF Size | 471 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_026554.4, NP_080830.1 |
RefSeq Size | 2054 bp |
RefSeq ORF | 471 bp |
Locus ID | 68092 |
UniProt ID | Q9CQ49 |
MW | 18 kDa |
Gene Summary | Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus via its interaction with ALYREF/THOC4/ALY, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC) via its interaction with UPF1, promoting the interaction between UPF1 and UPF2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being required for miRNA-mediated RNA interference. The CBC complex also acts as a negative regulator of PARN, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, NCBP2/CBP20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure. The conventional cap-binding complex with NCBP2 binds both small nuclear RNA (snRNA) and messenger (mRNA) and is involved in their export from the nucleus (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC210686 | Ncbp2 (untagged) - Mouse nuclear cap binding protein subunit 2 (Ncbp2), (10ug) |
CNY 3,990.00 |
|
MG219175 | Ncbp2 (tGFP-tagged) - Mouse nuclear cap binding protein subunit 2 (Ncbp2), (10ug) |
CNY 2,850.00 |
|
MR219175L3 | Lenti ORF clone of Ncbp2 (Myc-DDK-tagged) - Mouse nuclear cap binding protein subunit 2 (Ncbp2) |
CNY 4,750.00 |
|
MR219175L4 | Lenti ORF clone of Ncbp2 (mGFP-tagged) - Mouse nuclear cap binding protein subunit 2 (Ncbp2) |
CNY 4,750.00 |