Ptpn2 (NM_001127177) Mouse Tagged ORF Clone

CAT#: MR206379

  • TrueORF®

Ptpn2 (Myc-DDK-tagged) - Mouse protein tyrosine phosphatase, non-receptor type 2 (Ptpn2), transcript variant 2



  "NM_001127177" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,656.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AI325124; Ptpt; TC-PTP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR206379 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCAACCATCGAGCGGGAGTTCGAGGAACTGGATGCTCAGTGTCGCTGGCAGCCGTTATACTTGG
AAATTCGAAATGAATCCCATGACTATCCTCATAGAGTGGCCAAGTTTCCAGAAAACAGAAACCGAAACAG
ATACAGAGATGTAAGCCCATATGATCACAGTCGTGTTAAACTGCAAAGTACTGAAAATGATTATATTAAT
GCCAGCTTAGTTGACATAGAAGAGGCACAAAGAAGTTACATCTTAACACAGGGCCCACTTCCGAACACAT
GCTGCCATTTCTGGCTCATGGTGTGGCAGCAAAAGACCAAAGCAGTTGTCATGCTAAACCGAACTGTAGA
AAAAGAATCGGTTAAATGTGCACAGTACTGGCCAACGGATGACAGAGAAATGGTGTTTAAGGAAACGGGA
TTCAGTGTGAAGCTCTTATCTGAAGATGTAAAATCATATTATACAGTACATCTACTACAGTTAGAAAATA
TCAATACTGGTGAAACCAGAACCATATCTCACTTCCATTATACCACCTGGCCAGATTTTGGGGTTCCAGA
GTCACCAGCTTCATTTCTAAACTTCTTGTTTAAAGTTAGAGAATCTGGTTGTTTGACCCCTGACCATGGA
CCTGCAGTGATCCATTGCAGTGCGGGCATCGGGCGCTCTGGCACCTTCTCTCTTGTAGATACCTGTCTTG
TTCTGATGGAAAAAGGAGAGGATGTTAATGTGAAACAATTATTACTGAATATGAGAAAGTATCGAATGGG
ACTTATTCAGACACCGGACCAACTCAGATTCTCCTACATGGCCATAATAGAAGGAGCAAAGTACACAAAA
GGAGATTCAAATATACAGAAACGGTGGAAAGAACTTTCTAAAGAAGATTTATCTCCTATTTGTGATCATT
CACAGAACAGAGTGATGGTTGAGAAGTACAATGGGAAGAGAATAGGTTCAGAAGATGAAAAGTTAACAGG
GCTTCCTTCTAAGGTGCAGGATACTGTGGAGGAGAGCAGTGAGAGCATTCTACGGAAACGTATTCGAGAG
GATAGAAAGGCTACGACGGCTCAGAAGGTGCAGCAGATGAAACAGAGGCTAAATGAAACTGAACGAAAAA
GAAAAAGGTGGTTATATTGGCAACCTATTCTCACTAAGATGGGGTTTGTGTCAGTCATTTTGGTTGGCGC
TTTGGTTGGCTGGACACTGCTTTTTCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR206379 protein sequence
Red=Cloning site Green=Tags(s)

MSATIEREFEELDAQCRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQSTENDYIN
ASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKESVKCAQYWPTDDREMVFKETG
FSVKLLSEDVKSYYTVHLLQLENINTGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGCLTPDHG
PAVIHCSAGIGRSGTFSLVDTCLVLMEKGEDVNVKQLLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKYTK
GDSNIQKRWKELSKEDLSPICDHSQNRVMVEKYNGKRIGSEDEKLTGLPSKVQDTVEESSESILRKRIRE
DRKATTAQKVQQMKQRLNETERKRKRWLYWQPILTKMGFVSVILVGALVGWTLLFH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001127177
ORF Size 1221 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001127177.1, NP_001120649.1
RefSeq Size 8423 bp
RefSeq ORF 1221 bp
Locus ID 19255
UniProt ID Q06180
MW 47.4 kDa
Gene Summary Non-receptor type tyrosine-specific phosphatase that dephosphorylates receptor protein tyrosine kinases including INSR, EGFR, CSF1R, PDGFR. Also dephosphorylates non-receptor protein tyrosine kinases like JAK1, JAK2, JAK3, Src family kinases, STAT1, STAT3 and STAT6 either in the nucleus or the cytoplasm. Negatively regulates numerous signaling pathways and biological processes like hematopoiesis, inflammatory response, cell proliferation and differentiation, and glucose homeostasis. Plays a multifaceted and important role in the development of the immune system. Functions in T-cell receptor signaling through dephosphorylation of FYN and LCK to control T-cells differentiation and activation. Dephosphorylates CSF1R, negatively regulating its downstream signaling and macrophage differentiation. Negatively regulates cytokine (IL2/interleukin-2 and interferon)-mediated signaling through dephosphorylation of the cytoplasmic kinases JAK1, JAK3 and their substrate STAT1, that propagate signaling downstream of the cytokine receptors. Also regulates the IL6/interleukin-6 and IL4/interleukin-4 cytokine signaling through dephosphorylation of STAT3 and STAT6 respectively. In addition to the immune system, it is involved in anchorage-dependent, negative regulation of EGF-stimulated cell growth. Activated by the integrin ITGA1/ITGB1, it dephosphorylates EGFR and negatively regulates EGF signaling. Dephosphorylates PDGFRB and negatively regulates platelet-derived growth factor receptor-beta signaling pathway and therefore cell proliferation. Negatively regulates tumor necrosis factor-mediated signaling downstream via MAPK through SRC dephosphorylation. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of the hepatocyte growth factor receptor MET. Plays also an important role in glucose homeostasis. For instance, negatively regulates the insulin receptor signaling pathway through the dephosphorylation of INSR and control gluconeogenesis and liver glucose production through negative regulation of the IL6 signaling pathways. May also bind DNA.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...