Rnf146 (NM_001110198) Mouse Tagged ORF Clone

CAT#: MR205486

  • TrueORF®

Rnf146 (Myc-DDK-tagged) - Mouse ring finger protein 146 (Rnf146), transcript variant 2



  "NM_001110198" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 5,488.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 2610509H23Rik; Iduna
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR205486 representing NM_001110198
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGATGGCCGGCTGTGGTGAAATTGATCACTCAATAAATATGCTTCCTACAAATAAGAAGGCAAATG
AGTCCTGTTCCAATACTGCACCTTCTCTGACAGTTCCTGAATGTGCCATTTGTCTACAAACATGTGTTCA
CCCTGTCAGTCTGCCCTGTAAGCATGTTTTCTGTTATCTGTGTGTAAAGGGTGCTTCATGGCTTGGGAAG
CGATGTGCTCTTTGTCGACAAGAGATTCCTGAGGATTTTCTTGACAAGCCAACCTTGTTGTCACCAGAAG
AACTTAAGGCTGCAAGCAGAGGAAATGGTGAATATGCGTGGTATTATGAAGGAAGGAATGGGTGGTGGCA
GTATGATGAGCGCACTAGTCGGGAGCTAGAAGATGCTTTTTCCAAAGGTAAAAAGAACACGGAAATGTTA
ATTGCTGGATTTCTGTATGTTGCTGATCTTGAAAACATGGTTCAATATAGGAGAAATGAACATGGACGTC
GCAGGAAGATTAAGCGAGATATAATAGATATACCAAAGAAGGGAGTAGCTGGACTTAGGCTGGACTGTGA
CACCAATACTGTAAATCTAGCAAGAGAGAGTTCTGCTGATGGTGCGGACAGTGGATCAGCACAGACTGGA
GCTTCTGTTCAGCTTGCAGTGCCATCTTCTACAAGGCCCCTGACATCAGTTGATGGTCAGTTAACCAGCC
CTGTAACACCATCCCCTGATGCAGGCATTTCTTTGGAAGACTCTTTTGCTCATTTACAACTCAGTGGAGA
CAGCATAGCTGAACGGAGTCACAGAGGTGAAGGAGAAGAAGATCATGAATCGCCATCTTCTGGCAGAGTA
CCAGATACCTCCGTTGAAGAAACAGAATCAGATGCCAGTAGTGATAGTGAGGATGCCCCTGTGGTAGTTG
CACAGCACTCTTTGACCCAACAGAGACCTTTGGTTCCAAATGGAAACCAGACAGTAGCCGACCAGTCAGA
CCGATCAGGAACTGACCGATCAGTTGCAGGGGGTGGGACCATGAGTGTCAATGTCAGATCCAGAAGGCCT
GATGGGCAGTGCACAGTGACAGAGGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205486 representing NM_001110198
Red=Cloning site Green=Tags(s)

MEMAGCGEIDHSINMLPTNKKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGK
RCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEML
IAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDTNTVNLARESSADGADSGSAQTG
ASVQLAVPSSTRPLTSVDGQLTSPVTPSPDAGISLEDSFAHLQLSGDSIAERSHRGEGEEDHESPSSGRV
PDTSVEETESDASSDSEDAPVVVAQHSLTQQRPLVPNGNQTVADQSDRSGTDRSVAGGGTMSVNVRSRRP
DGQCTVTEV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001110198
ORF Size 1077 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001110198.1, NP_001103668.1
RefSeq Size 4400 bp
RefSeq ORF 1080 bp
Locus ID 68031
UniProt ID Q9CZW6
MW 39.4 kDa
Gene Summary E3 ubiquitin-protein ligase that specifically binds poly-ADP-ribosylated (PARsylated) proteins and mediates their ubiquitination and subsequent degradation. May regulate many important biological processes, such as cell survival and DNA damage response. Acts as an activator of the Wnt signaling pathway by mediating the ubiquitination of PARsylated AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex. Acts in cooperation with tankyrase proteins (TNKS and TNKS2), which mediate PARsylation of target proteins AXIN1, AXIN2, BLZF1, CASC3, TNKS and TNKS2. Recognizes and binds tankyrase-dependent PARsylated proteins via its WWE domain and mediates their ubiquitination (By similarity). May regulate TNKS and TNKS2 subcellular location, preventing aggregation at a centrosomal location. Neuroprotective protein. Protects the brain against N-methyl-D-aspartate (NMDA) receptor-mediated glutamate excitotoxicity and ischemia, by interfering with PAR-induced cell death, called parthanatos. Prevents nuclear translocation of AIFM1 in a PAR-binding dependent manner. Does not affect PARP1 activation (By similarity). Protects against cell death induced by DNA damaging agents, such as N-methyl-N-nitro-N-nitrosoguanidine (MNNG) and rescues cells from G1 arrest. Promotes cell survival after gamma-irradiation. Facilitates DNA repair. Neuroprotective protein. Protects the brain against N-methyl-D-aspartate (NMDA) receptor-mediated glutamate excitotoxicity and ischemia, by interfering with PAR-induced cell death, called parthanatos. Prevents nuclear translocation of AIFM1 in a PAR-binding dependent manner. Does not affect PARP1 activation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...