Cd5l (NM_009690) Mouse Tagged ORF Clone

CAT#: MR205357

  • TrueORF®

Cd5l (Myc-DDK-tagged) - Mouse CD5 antigen-like (Cd5l)

ORF Plasmid: DDK tGFP



  "NM_009690" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,656.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1/6; AAC-11; AI047839; Api6; CT2; mAIM; Pdp; Sp-alpha
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR205357 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCATTGTTCAACTTGATGCTGGCCATCTTGAGCATTTTTGTTGGATCGTGTTTTTCAGAGTCTC
CAACCAAAGTGCAGCTAGTGGGAGGTGCCCACCGCTGTGAAGGGCGAGTGGAGGTGGAACACAATGGCCA
GTGGGGGACTGTGTGTGATGATGGCTGGGACCGGCGTGATGTGGCTGTGGTGTGCCGAGAGCTCAATTGT
GGAGCAGTCATCCAAACCCCGCGTGGCGCATCATATCAGCCACCAGCATCAGAGCAAAGAGTTCTTATTC
AAGGGGTTGACTGCAACGGAACGGAAGACACGTTGGCTCAATGTGAGCTAAATTACGATGTTTTTGACTG
CTCACATGAAGAAGATGCTGGGGCACAGTGTGAGAACCCAGACAGTGACCTCCTCTTCATTCCAGAGGAT
GTGCGTCTAGTAGATGGCCCGGGGCACTGCCAGGGTCGAGTGGAGGTGCTCCACCAGTCCCAGTGGAGCA
CTGTGTGTAAAGCAGGCTGGAACTTACAGGTCTCAAAGGTGGTGTGCAGGCAGCTCGGGTGTGGGCGGGC
ATTACTGACCTACGGAAGCTGCAACAAGAGTACTCAGGGCAAAGGACCCATCTGGATGGGCAAGATGTCG
TGTTCTGGACAAGAAGCAAACCTTCGGTCTTGCCTTTTGAGTCGTTTGGAGAACAACTGTACCCATGGCG
AGGACACATGGATGGAATGTGAAGATCCTTTTGAGCTGAAGCTGGTGGGAGGAGACACCCCCTGCTCTGG
GAGGTTGGAGGTGCTGCACAAGGGTTCCTGGGGCTCCGTCTGTGATGACAACTGGGGAGAAAAGGAGGAC
CAAGTGGTCTGCAAGCAACTGGGTTGTGGGAAGTCCCTCCATCCATCCCCCAAAACCCGGAAAATCTATG
GGCCTGGGGCAGGCCGCATCTGGCTGGATGACGTCAACTGCTCAGGGAAGGAACAGTCTCTGGAGTTCTG
CCGGCACAGGTTGTGGGGGTACCACGACTGTACCCACAAGGAAGATGTGGAGGTGATCTGCACAGACTTT
GATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205357 protein sequence
Red=Cloning site Green=Tags(s)

MAPLFNLMLAILSIFVGSCFSESPTKVQLVGGAHRCEGRVEVEHNGQWGTVCDDGWDRRDVAVVCRELNC
GAVIQTPRGASYQPPASEQRVLIQGVDCNGTEDTLAQCELNYDVFDCSHEEDAGAQCENPDSDLLFIPED
VRLVDGPGHCQGRVEVLHQSQWSTVCKAGWNLQVSKVVCRQLGCGRALLTYGSCNKSTQGKGPIWMGKMS
CSGQEANLRSCLLSRLENNCTHGEDTWMECEDPFELKLVGGDTPCSGRLEVLHKGSWGSVCDDNWGEKED
QVVCKQLGCGKSLHPSPKTRKIYGPGAGRIWLDDVNCSGKEQSLEFCRHRLWGYHDCTHKEDVEVICTDF
DV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009690
ORF Size 1059 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_009690.1, NM_009690.2, NP_033820.1
RefSeq Size 2037 bp
RefSeq ORF 1059 bp
Locus ID 11801
UniProt ID Q9QWK4
MW 38.8 kDa
Gene Summary Secreted protein that acts as a key regulator of lipid synthesis: mainly expressed by macrophages in lymphoid and inflamed tissues and regulates mechanisms in inflammatory responses, such as infection or atherosclerosis (PubMed:26048980). Able to inhibit lipid droplet size in adipocytes (PubMed:20519120, PubMed:22579686). Following incorporation into mature adipocytes via CD36-mediated endocytosis, associates with cytosolic FASN, inhibiting fatty acid synthase activity and leading to lipolysis, the degradation of triacylglycerols into glycerol and free fatty acids (FFA) (PubMed:20519120). CD5L-induced lipolysis occurs with progression of obesity: participates in obesity-associated inflammation following recruitment of inflammatory macrophages into adipose tissues, a cause of insulin resistance and obesity-related metabolic disease (PubMed:21730133). Regulation of intracellular lipids mediated by CD5L has a direct effect on transcription regulation mediated by nuclear receptors ROR-gamma (RORC) (PubMed:22579686, PubMed:26607793). Acts as a key regulator of metabolic switch in T-helper Th17 cells (PubMed:26607794, PubMed:26607793). Regulates the expression of pro-inflammatory genes in Th17 cells by altering the lipid content and limiting synthesis of cholesterol ligand of RORC, the master transcription factor of Th17-cell differentiation (PubMed:26607793). CD5L is mainly present in non-pathogenic Th17 cells, where it decreases the content of polyunsaturated fatty acyls (PUFA), affecting two metabolic proteins MSMO1 and CYP51A1, which synthesize ligands of RORC, limiting RORC activity and expression of pro-inflammatory genes (PubMed:26607793). Participates in obesity-associated autoimmunity via its association with IgM, interfering with the binding of IgM to Fcalpha/mu receptor and enhancing the development of long-lived plasma cells that produce high-affinity IgG autoantibodies (PubMed:23562157). Also acts as an inhibitor of apoptosis in macrophages: promotes macrophage survival from the apoptotic effects of oxidized lipids in case of atherosclerosis (PubMed:9892623, PubMed:16054063). Involved in early response to microbial infection against various pathogens by acting as a pattern recognition receptor and by promoting autophagy (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...