Map2k6 (NM_011943) Mouse Tagged ORF Clone

CAT#: MR204942

  • TrueORF®

Map2k6 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase kinase 6 (Map2k6)

ORF Plasmid: DDK tGFP



  "NM_011943" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,656.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms MEK6; MKK6; Prkmk6; SAPKK3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204942 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCAGTCGAAAGGCAAGAAGCGAAACCCGGGCCTTAAGATTCCAAAAGAAGCGTTTGAACAGCCTC
AGACCAGTTCCACGCCGCCTCGGGATTTAGACTCCAAGGCTTGCATATCTATTGGAAACCAGAACTTTGA
GGTGAAGGCAGATGACCTGGAGCCGATAGTGGAGCTGGGACGAGGTGCGTACGGGGTGGTGGAGAAGATG
CGTCACGTGCCCAGCGGGCAGATCATGGCAGTGAAGCGGATACGGGCCACAGTTAATAGCCAGGAACAGA
AACGGCTGCTGATGGATTTGGATGTCTCCATGAGGACGGTGGACTGTCCATTCACCGTGACCTTCTACGG
TGCACTCTTCCGGGAGGGCGACGTGTGGATCTGCATGGAGCTCATGGATACGTCACTAGATAAATTCTAC
AAACAAGTTATTGATAAAGGCCAAACAATTCCAGAGGATATCTTAGGAAAGATAGCAGTTTCTATTGTAA
AAGCGTTAGAACATTTACACAGTAAGCTGTCTGTTATCCATCGAGACGTCAAGCCTTCTAATGTGCTCAT
TAACACACTGGGCCAGGTGAAGATGTGTGACTTTGGAATCAGTGGCTACCTGGTCGACTCTGTTGCTAAA
ACGATCGATGCCGGTTGCAAACCATACATGGCTCCTGAACGAATAAATCCAGAGCTCAACCAGAAGGGGT
ACAGTGTGAAGTCTGACATTTGGAGCCTGGGCATCACCATGATCGAGCTGGCCATCCTTCGGTTTCCTTA
TGATTCTTGGGGAACGCCCTTCCAGCAGCTAAAGCAGGTGGTCGAAGAGCCCTCTCCTCAGCTCCCAGCA
GACAAGTTCTCCGCGGACTTTGTTGACTTTACCTCACAGTGCTTGAAGAAAAATTCCAAAGAACGGCCCA
CATATCCAGAGCTTATGCAACATCCATTTTTCACCGTACATGAATCCAAAGCAGCAGACGTGGCATCTTT
TGTAAAACTGATACTTGGGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204942 protein sequence
Red=Cloning site Green=Tags(s)

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKM
RHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFY
KQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSVAK
TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA
DKFSADFVDFTSQCLKKNSKERPTYPELMQHPFFTVHESKAADVASFVKLILGD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011943
ORF Size 1005 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011943.3
RefSeq Size 2064 bp
RefSeq ORF 1005 bp
Locus ID 26399
UniProt ID P70236
MW 37.4 kDa
Gene Summary Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...