Morf4l1 (NM_024431) Mouse Tagged ORF Clone

CAT#: MR204686

  • TrueORF®

Morf4l1 (Myc-DDK-tagged) - Mouse mortality factor 4 like 1 (Morf4l1), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_024431" in other vectors (5)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Goat Anti-MRG15 / MORF4L1 Antibody
    • 100 ug

CNY 5,371.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms mKIAA4002; MORFRG15; MRG15; TEG-189; Tex189
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204686 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCCAAGCAGGACCCTAAGCCGAAATTCCAGGAGGGCGAGCGAGTGCTGTGCTTTCATGGGCCTC
TTCTCTATGAAGCAAAGTGTGTAAAGGTTGCCATAAAGGACAAACAAGTGAAATACTTCATCCATTACAG
TGGCTGGAATAAAAATTGGGATGAATGGGTGCCAGAAAGCAGAGTACTCAAATACGTGGACACCAATTTG
CAGAAACAGCGAGAACTTCAAAAGGCCAATCAGGAACAATATGCAGAGGGCAAGATGAGAGGGGCTGCTC
CGGGGAAGAAGACATCCGGTCTGCAACAGAAAAATGTTGAAGTGAAAACAAAAAAGAACAAGCAGAAAAC
ACCTGGAAATGGAGATGGTGGCAGTACCAGTGAGACACCTCAGCCTCCTAGGAAGAAGAGAGCCCGGGTA
GATCCTACCGTTGAAAATGAAGAAACCTTCATGAACAGAGTTGAAGTTAAAGTGAAGATTCCTGAAGAGC
TGAAACCCTGGCTTGTGGATGACTGGGACTTGATCACCAGACAGAAGCAGCTTTTTTATCTTCCTGCCAA
GAAGAATGTGGATTCCATTTTGGAGGATTATGCAAATTATAAGAAGTCTCGAGGAAATACAGATAATAAA
GAGTATGCTGTTAATGAGGTGGTGGCAGGCATAAAGGAGTACTTCAATGTCATGTTGGGCACTCAGCTCC
TCTACAAGTTTGAGAGACCACAGTACGCTGAAATCCTCGCCGACCACCCGGATGCGCCCATGTCCCAGGT
GTACGGAGCGCCACATTTGCTGAGATTATTTGTGCGAATTGGAGCGATGTTGGCCTACACGCCTCTAGAT
GAGAAAAGCCTTGCTTTATTACTGAACTATCTACATGATTTTCTCAAGTACCTGGCGAAGAATTCTGCAA
CCTTGTTCAGTGCCAGTGATTATGAAGTGGCCCCTCCTGAGTACCACCGGAAAGCCGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204686 protein sequence
Red=Cloning site Green=Tags(s)

MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL
QKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARV
DPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK
EYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLD
EKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024431
ORF Size 972 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_024431.1, NM_024431.2, NM_024431.3, NP_077751.1
RefSeq Size 1896 bp
RefSeq ORF 972 bp
Locus ID 21761
UniProt ID P60762
MW 37.2 kDa
Gene Summary Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...