Dpf3 (BC048572) Mouse Tagged ORF Clone

CAT#: MR204514

  • TrueORF®

Dpf3 (Myc-DDK-tagged) - Mouse D4, zinc and double PHD fingers, family 3 (cDNA clone MGC:58591 IMAGE:6705809)

ORF Plasmid: DDK tGFP



  "BC048572" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,140.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Dpf3 Antibody - N-terminal region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms CERD4, cer-d4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204514 representing BC048572
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGCTTGCCCAAGGGCCACAACAGGCCTGGGGCCTGGATGGAGAAGAGGCACCGCGGCCCAGGCC
TCGCTCCGGGCCAGTTGTACACATACCCTGCCCGCTGCTGGCGCAAGAAGCGACGATTGCACCCACCAGA
GGACCCAAAACTACGACTCCTGGAAATCAAACCCGAAGTAGAACTGCCCCTGAAGAAAGATGGATTTACC
TCTGAGAGTACCACACTGGAAGCCTTGCTTCGCGGCGAGGGAGTAGAGAAGAAGGTGGATGCCAGAGAAG
AGGAAAGCATCCAGGAGATACAGAGGGTTTTGGAAAATGATGAAAACGTAGAAGAAGGGAATGAAGAGGA
GGATTTGGAAGAAGATGTTCCCAAGCGCAAGAACAGGACCAGAGGACGGGCTCGCGGCTCTGCAGGCGGA
AGGAGGAGGCATGATGCCGCCTCTCAGGAAGACCACGACAAACCCTACGTCTGCGACATCTGTGGCAAGC
GCTACAAGAACCGGCCAGGACTCAGCTACCACTACGCTCATACTCACCTGGCCAGCGAGGAGGGAGACGA
AGCCCAAGACCAGGAGACCCGATCCCCACCCAACCACAGAAATGAGAACCACAGACCCCAGAAAGGACCA
GACGGGACAGTCATTCCTAATAACTACTGTGACTTCTGCTTGGGGGGCTCCAACATGAACAAGAAGAGTG
GGAGGCCTGAAGAGCTGGTGTCCTGTGCAGACTGTGGACGCTCTGCTCATTTGGGAGGAGAAGGCAGGAA
GGAGAAGGAGGCAGCGGCCGCAGCACGTACCACGGAGGACTTATTCGGTTCCACGTCAGAAAGTGACACC
TCAACTTTCTACGGCTTTGATGAGGACGATTTGGAAGAGCCTCGCTCCTGTCGAGGACGCCGCAGTGGCC
GGGGTTCACCCACAGCAGATAAAAAGGGCAGCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204514 representing BC048572
Red=Cloning site Green=Tags(s)

MGCLPKGHNRPGAWMEKRHRGPGLAPGQLYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFT
SESTTLEALLRGEGVEKKVDAREEESIQEIQRVLENDENVEEGNEEEDLEEDVPKRKNRTRGRARGSAGG
RRRHDAASQEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPNHRNENHRPQKGP
DGTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSAHLGGEGRKEKEAAAAARTTEDLFGSTSESDT
STFYGFDEDDLEEPRSCRGRRSGRGSPTADKKGSC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC048572
ORF Size 945 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC048572.1
RefSeq Size 1123 bp
RefSeq ORF 947 bp
Locus ID 70127
MW 41.1 kDa
Gene Summary Muscle-specific component of the BAF complex, a multiprotein complex involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Specifically binds acetylated lysines on histone 3 and 4 (H3K14ac, H3K9ac, H4K5ac, H4K8ac, H4K12ac, H4K16ac). In the complex, it acts as a tissue-specific anchor between histone acetylations and methylations and chromatin remodeling. It thereby probably plays an essential role in heart and skeletal muscle development (By similarity). Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...