Exosc3 (NM_025513) Mouse Tagged ORF Clone

CAT#: MR203681

  • TrueORF®

Exosc3 (Myc-DDK-tagged) - Mouse exosome component 3 (Exosc3)

ORF Plasmid: DDK tGFP



  "NM_025513" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 2310005D06Rik; AI593501; Rrp40
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203681 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAAGTACTGTCCGCGGGACCCGAGTCGGTGGCGGGCTGCCGAGCACGGGCCGTGCACAAGGTGC
TGAATCAGGTGGTTCTCCCCGGGGAGGAGCTGGTGCTGCCGGACCACGAGGACGTAGACGGCCTTGGCGG
CGCCGGGGAGCAGCCGTTACGCCTGAATGCGGGTGCGCGCCCGAGGCTGCGCGTAGTGTGTGGCCCAGGT
TTGCGACGCTGCGGGGACCGTCTGCTGGTCACCAAGTGTGGCCGCCTGCGTCACAAGGAGCCCAGCGGAG
GCGGCGGCGGCGTTTACTGGGTGGACTCGCAGCAGAAGCGGTATGTACCTGTGAAAGGGGACCACGTGAT
TGGCATAGTGATCGCTAAATCTGGAGATATATTCAAAGTTGATGTTGGAGGGAGTGAGCCAGCGTCTTTG
TCTTACCTGGCATTTGAAGGGGCAACTAAAAGAAACAGACCAAATGTGCAGGTTGGAGATCTCATCTATG
GCCAGTGTGTGGTCGCTAATAAAGACATGGAACCAGAGATGGTCTGCATTGACAGCTGTGGCCGCGCCAA
TGGGATGGGTGTGATTGGGCAGGATGGCCTGCTCTTCAAAGTGACGTTGGGCTTAATTAGAAAGCTATTA
GCTCCAGATTGTGAAATTGTGCAAGAGCTGGGAAAACTCTATCCGTTGGAGATTGTGTTTGGAATGAATG
GAAGAATATGGGTCAAAGCTAAGACCATTCAGCAGACGTTAATTTTGGCAAATGTCTTAGAAGCTTGTGA
ACACATGACAACAGAGCAAAGAAAACAGATCTTTGCCAGACTGGCAGAGAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203681 protein sequence
Red=Cloning site Green=Tags(s)

MAEVLSAGPESVAGCRARAVHKVLNQVVLPGEELVLPDHEDVDGLGGAGEQPLRLNAGARPRLRVVCGPG
LRRCGDRLLVTKCGRLRHKEPSGGGGGVYWVDSQQKRYVPVKGDHVIGIVIAKSGDIFKVDVGGSEPASL
SYLAFEGATKRNRPNVQVGDLIYGQCVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLL
APDCEIVQELGKLYPLEIVFGMNGRIWVKAKTIQQTLILANVLEACEHMTTEQRKQIFARLAES

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025513
ORF Size 825 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025513.1, NM_025513.2, NM_025513.3, NP_079789.1
RefSeq Size 1035 bp
RefSeq ORF 825 bp
Locus ID 66362
UniProt ID Q7TQK4
MW 29.5 kDa
Gene Summary Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC3 as peripheral part of the Exo-9 complex stabilizes the hexameric ring of RNase PH-domain subunits through contacts with EXOSC9 and EXOSC5 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...