Ebi3 (NM_015766) Mouse Tagged ORF Clone

CAT#: MR202722

  • TrueORF®

Ebi3 (Myc-DDK-tagged) - Mouse Epstein-Barr virus induced gene 3 (Ebi3)

ORF Plasmid: DDK tGFP



  "NM_015766" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1,416.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms EBI-3; IL-27
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202722 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAAGCTGCTCTTCCTGTCACTTGCCCTCTGGGCCAGCCGCTCCCCTGGTTACACTGAAACAGCTC
TCGTGGCTCTAAGCCAGCCCAGAGTGCAATGCCATGCTTCTCGGTATCCCGTGGCCGTGGACTGCTCCTG
GACTCCTCTCCAGGCTCCCAACTCCACCAGATCCACGTCCTTCATTGCCACTTACAGGCTCGGTGTGGCC
ACCCAGCAGCAGAGCCAGCCCTGCCTACAACGGAGCCCCCAGGCCTCCCGATGCACCATCCCCGACGTGC
ACCTGTTCTCCACGGTGCCCTACATGCTAAATGTCACTGCAGTGCACCCAGGCGGCGCCAGCAGCAGCCT
CCTAGCCTTTGTGGCTGAGCGAATCATCAAGCCGGACCCTCCGGAAGGCGTGCGCCTGCGCACAGCGGGA
CAGCGCCTGCAGGTGCTCTGGCATCCCCCTGCTTCCTGGCCCTTCCCGGACATCTTCTCTCTCAAGTACC
GACTCCGCTACCGGCGCCGAGGAGCCTCTCACTTCCGCCAGGTGGGACCCATTGAAGCCACGACTTTCAC
CCTCAGGAACTCGAAACCCCATGCCAAGTATTGCATCCAGGTGTCAGCTCAGGACCTCACAGATTATGGG
AAACCAAGTGACTGGAGCCTCCCTGGGCAAGTAGAAAGTGCACCCCATAAGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202722 protein sequence
Red=Cloning site Green=Tags(s)

MSKLLFLSLALWASRSPGYTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVA
TQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAG
QRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYG
KPSDWSLPGQVESAPHKP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015766
ORF Size 687 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015766.2, NP_056581.1
RefSeq Size 1187 bp
RefSeq ORF 687 bp
Locus ID 50498
UniProt ID O35228
MW 25.4 kDa
Gene Summary Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...