Npc2 (NM_023409) Mouse Tagged ORF Clone

CAT#: MR201050

  • TrueORF®

Npc2 (Myc-DDK-tagged) - Mouse Niemann Pick type C2 (Npc2)

ORF Plasmid: DDK tGFP



  "NM_023409" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1,200.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Goat Anti-Npc2 (mouse) (aa21-33) Antibody
    • 100 ug

CNY 5,371.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 2700012J19Rik; AA408070; AU045843; HE1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201050 representing NM_023409
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGTTTTCTGGCCGCCACGATCCTGCTGCTGGCGCTGGTCGCTGCCAGCCAGGCGGAGCCCCTGCACT
TCAAGGACTGCGGCTCTAAGGTGGGAGTTATAAAGGAGGTGAATGTGAGCCCATGTCCCACCGATCCCTG
TCAGCTGCACAAAGGCCAGTCCTACAGTGTCAACATCACCTTTACCAGCGGCACTCAGTCCCAGAACAGC
ACGGCCTTGGTCCACGGCATCCTGGAAGGGATCCGGGTCCCCTTCCCTATTCCTGAGCCTGACGGTTGTA
AGAGTGGAATCAACTGCCCCATCCAGAAAGACAAGGTCTACAGCTACCTGAATAAGCTTCCGGTGAAGAA
TGAATACCCCTCTATAAAACTGGTGGTGGAATGGAAACTTGAAGATGACAAAAAGAATAATCTCTTCTGC
TGGGAGATCCCAGTTCAGATCACAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201050 representing NM_023409
Red=Cloning site Green=Tags(s)

MRFLAATILLLALVAASQAEPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNS
TALVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFC
WEIPVQITS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_023409
ORF Size 447 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_023409.4, NP_075898.1
RefSeq Size 3278 bp
RefSeq ORF 450 bp
Locus ID 67963
UniProt ID Q9Z0J0
MW 16.9 kDa
Gene Summary Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the lysosomal compartment (PubMed:12591949, PubMed:17018531, PubMed:21315718, PubMed:26296895). Unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes is transferred by NPC2 to the cholesterol-binding pocket in the N-terminal domain of NPC1. May bind and mobilize cholesterol that is associated with membranes. NPC2 binds cholesterol with a 1:1 stoichiometry. Can bind a variety of sterols, including lathosterol, desmosterol and the plant sterols stigmasterol and beta-sitosterol (By similarity). The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport (PubMed:21315718).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...