Nat13 (BC046283) Mouse Tagged ORF Clone
CAT#: MR200708
- TrueORF®
Nat13 (Myc-DDK-tagged) - Mouse N-acetyltransferase 13 (cDNA clone MGC:54829 IMAGE:6438976)
ORF Plasmid: tGFP
"BC046283" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 2,945.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 2600005K24Rik; 2810441M03Rik; AW112078; Mak3; Mak3p; Nat5; Nat13; San |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200708 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAAGGTAGCCGGATCGAGCTGGGAGATGTGACGCCACACAATATTAAACAGTTGAAGAGACTGAACC AGGTCATCTTTCCAGTCAGCTATAATGATAAATTCTACAAGGATGTGCTAGAGGTTGGCGAGCTAGCAAA ACTTGGAACTAAAATGTTAAATCATGTCCTAAACATCTGTGAGAAGGATGGCACTTTTGACAATATCTAT CTGCATGTCCAGATCAGCAATGAGTCAGCGATTGACTTTTACCGGAAGTTTGGCTTTGAGATTATCGAGA CAAAGAAGAACTACTATAAGAGGATAGAGCCTGCAGACGCGCATGTGCTTCAGAAAAACCTCAAAGTCCC ATCTGGTCAGAATGCAGAGACACAGAAGACAGACAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200708 protein sequence
Red=Cloning site Green=Tags(s) MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLGTKMLNHVLNICEKDGTFDNIY LHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNAETQKTDN myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC046283 |
ORF Size | 387 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC046283, AAH46283 |
RefSeq Size | 2187 bp |
RefSeq ORF | 389 bp |
Locus ID | 72117 |
MW | 14.9 kDa |
Gene Summary | N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine. Has a broad substrate specificity: able to acetylate the initiator methionine of most peptides, except for those with a proline in second position. Also displays N-epsilon-acetyltransferase activity by mediating acetylation of the side chain of specific lysines on proteins. Autoacetylates in vivo. The relevance of N-epsilon-acetyltransferase activity is however unclear: able to acetylate H4 in vitro, but this result has not been confirmed in vivo. Component of a N-alpha-acetyltransferase complex containing NAA10 and NAA15, but NAA50 does not influence the acetyltransferase activity of NAA10: this multiprotein complex probably constitutes the major contributor for N-terminal acetylation at the ribosome exit tunnel, with NAA10 acetylating all amino termini that are devoid of methionine and NAA50 acetylating other peptides. Required for sister chromatid cohesion during mitosis by promoting binding of CDCA5/sororin to cohesin: may act by counteracting the function of NAA10.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC206945 | Nat13 (untagged) - Mouse N-acetyltransferase 13 (cDNA clone MGC:54829 IMAGE:6438976), (10ug) |
CNY 3,230.00 |
|
MG200708 | Nat13 (tGFP-tagged) - Mouse N-acetyltransferase 13 (cDNA clone MGC:54829 IMAGE:6438976) |
CNY 2,850.00 |
|
MR200708L3 | Lenti ORF clone of Nat13 (Myc-DDK-tagged) - Mouse N-acetyltransferase 13 (cDNA clone MGC:54829 IMAGE:6438976) |
CNY 4,750.00 |
|
MR200708L4 | Lenti ORF clone of Nat13 (mGFP-tagged) - Mouse N-acetyltransferase 13 (cDNA clone MGC:54829 IMAGE:6438976) |
CNY 4,750.00 |