Ptgds (BC038083) Mouse Tagged ORF Clone
CAT#: MR200672
- TrueORF®
Ptgds (Myc-DDK-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308)
ORF Plasmid: tGFP
"BC038083" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 2,945.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | PGD2, L-PGDS, 21kDa |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200672 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGCAAGACAGTGGTAGCCCCCTCCACAGAAGGCGGCCTCAATCTCACCTCTACCTTCCTCAGGAAAA ACCAGTGTGAGACCAAGATCATGGTACTGCAGCCTGCGGGGGCTCCTGGACACTACACCTACAGCAGCCC CCACTCGGGCAGCATCCACTCCGTGTCAGTGGTGGAGGCCAACTATGACGAGTACGCTCTGCTATTCAGC AGAGGCACCAAGGGCCCAGGCCAGGACTTCCGCATGGCCACCCTCTACAGCAGAACCCAGACTCTGAAGG ACGAGCTGAAGGAGAAATTCACCACCTTTAGCAAGGCCCAGGGCCTCACAGAGGAGGACATTGTTTTCCT GCCCCAACCGGATAAGTGCATTCAAGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200672 protein sequence
Red=Cloning site Green=Tags(s) MCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFS RGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC038083 |
ORF Size | 378 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | BC038083, AAH38083 |
RefSeq Size | 1354 bp |
RefSeq ORF | 380 bp |
Locus ID | 19215 |
MW | 13.9 kDa |
Gene Summary | Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophobic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system.[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Transferrin is responsible for mediating the effects of iron ions on the regulation of anterior pharynx-defective-1α/β and Presenilin 1 expression via PGE2 and PGD2 at the early stage of Alzheimer’s Disease
,Lu, CD;Ma, JK;Luo, ZY;Tai, QX;Wang, P;,
http://www.aging-us.com/ 2018
,PubMed ID 30383537
[PTGDS]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC206847 | Ptgds (untagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308), (10ug) |
CNY 1,200.00 |
|
MG200672 | Ptgds (tGFP-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308) |
CNY 2,800.00 |
|
MR200672L3 | Lenti ORF clone of Ptgds (Myc-DDK-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308) |
CNY 4,750.00 |
|
MR200672L4 | Lenti ORF clone of Ptgds (mGFP-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308) |
CNY 4,750.00 |