Uxt (BC029258) Mouse Tagged ORF Clone
CAT#: MR200565
- TrueORF®
Uxt (Myc-DDK-tagged) - Mouse ubiquitously expressed transcript (cDNA clone MGC:35979 IMAGE:4483276)
ORF Plasmid: tGFP
"BC029258" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 2,945.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 0910002B17Rik |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200565 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGACGCCCCCGAAACGGCGGGCCTTGGATATGGTGGGGGAGAAAGTGCTGCGGTACGAGACCTTTA TCAGTGACGTACTGCAGCGAGACTTGCAAAAGGTGCTGGATCATCGAGACAAGGTATATGAGCAGCTGTC CGTATATCTTCAACTAAGAAATGTCATTGAGCGACTCCAGGAAACTAATCACTCGGAGTTATATATGCAG GTGGATTTGGGCTGTAACTTCTTCGTTGACACAGTGGTCCCAGATACTTCACGCATCTATGTGGCCCTGG GATATGGTTTTTTCCTGGAACTGACACTGGCTGAAGCACTCAAGTTCATTGACCGAAAGAGTTCTCTCCT CACAGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200565 protein sequence
Red=Cloning site Green=Tags(s) MATPPKRRALDMVGEKVLRYETFISDVLQRDLQKVLDHRDKVYEQLSVYLQLRNVIERLQETNHSELYMQ VDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTE myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC029258 |
ORF Size | 357 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC029258, AAH29258 |
RefSeq Size | 701 bp |
RefSeq ORF | 359 bp |
Locus ID | 22294 |
MW | 13.9 kDa |
Gene Summary | Involved in gene transcription regulation. Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription. Together with URI1, associates with chromatin to the NKX3-1 promoter region. Negatively regulates the transcriptional activity of the estrogen receptor ESR1 by inducing its translocation into the cytoplasm. May act as nuclear chaperone that facilitates the formation of the NF-kappa-B enhanceosome and thus positively regulates NF-kappa-B transcription activity. Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling. Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC206862 | Uxt (untagged) - Mouse ubiquitously expressed transcript (cDNA clone MGC:35979 IMAGE:4483276), (10ug) |
CNY 3,230.00 |
|
MG200565 | Uxt (tGFP-tagged) - Mouse ubiquitously expressed transcript (cDNA clone MGC:35979 IMAGE:4483276) |
CNY 2,850.00 |
|
MR200565L3 | Lenti ORF clone of Uxt (Myc-DDK-tagged) - Mouse ubiquitously expressed transcript (cDNA clone MGC:35979 IMAGE:4483276) |
CNY 4,750.00 |
|
MR200565L4 | Lenti ORF clone of Uxt (mGFP-tagged) - Mouse ubiquitously expressed transcript (cDNA clone MGC:35979 IMAGE:4483276) |
CNY 4,750.00 |