Atpif1 (NM_007512) Mouse Tagged ORF Clone
CAT#: MR200378
- TrueORF®
Atpif1 (Myc-DDK-tagged) - Mouse ATPase inhibitory factor 1 (Atpif1), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
"NM_007512" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ATP5IF1; Atpi; If; IF(1); If1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200378 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGGCTCGGCGTTGGCAGTTCGGGCTCGGTTCGGTGTCTGGGGTATGAAGGTCCTGCAAACCCGAG GCTTCGTCTCGGACTCGTCGGATAGCATGGATACGGGCGCTGGCTCCATCCGAGAAGCTGGTGGAGCCTT CGGAAAACGAGAAAAGGCTGAAGAGGATCGGTACTTCCGAGAGAAGACTAAAGAACAGCTGGCTGCCCTG AGGAAACACCATGAAGATGAGATTGACCACCATTCGAAGGAGATAGAGCGTCTGCAGAAGCAAATTGAAC GCCATAAGAAGAAGATCCAACAACTAAAGAATAATCAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200378 protein sequence
Red=Cloning site Green=Tags(s) MAGSALAVRARFGVWGMKVLQTRGFVSDSSDSMDTGAGSIREAGGAFGKREKAEEDRYFREKTKEQLAAL RKHHEDEIDHHSKEIERLQKQIERHKKKIQQLKNNH myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_007512 |
ORF Size | 321 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_007512.4 |
RefSeq Size | 552 bp |
RefSeq ORF | 321 bp |
Locus ID | 11983 |
UniProt ID | O35143 |
MW | 12.2 kDa |
Gene Summary | This gene encodes a member of the ATPase inhibitor family of proteins. This protein has been shown to negatively regulate the ATP hydrolysis activity of the F1Fo-ATPase. Knockdown of this gene is associated with reduced heme synthesis in differentiating erythroid cells. Misregulation of this gene has been found to lead to increased aerobic glycolysis in mouse cancer cells, while high expression levels of this gene have been correlated with gastric and liver cancer severity in human patients. A pseudogene of this gene has been identified. [provided by RefSeq, Apr 2015] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC200851 | Atpif1 (untagged) - Mouse ATPase inhibitory factor 1 (Atpif1), nuclear gene encoding mitochondrial protein, (10ug) |
CNY 1,200.00 |
|
MG200378 | Atpif1 (tGFP-tagged) - Mouse ATPase inhibitory factor 1 (Atpif1) |
CNY 2,850.00 |
|
MR200378L3 | Lenti ORF clone of Atpif1 (Myc-DDK-tagged) - Mouse ATPase inhibitory factor 1 (Atpif1), nuclear gene encoding mitochondrial protein |
CNY 4,750.00 |
|
MR200378L4 | Lenti ORF clone of Atpif1 (mGFP-tagged) - Mouse ATPase inhibitory factor 1 (Atpif1), nuclear gene encoding mitochondrial protein |
CNY 4,750.00 |