Selenow (NM_009156) Mouse Tagged ORF Clone
CAT#: MR200204
- TrueORF®
Txnrd3 (Myc-DDK-tagged) - Mouse thioredoxin reductase 3 (Txnrd3), transcript variant 1, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
ORF Plasmid: tGFP
"NM_009156" in other vectors (2)
Need custom modification / cloning service?
Get a free quote
CNY 998.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Untagged ORF Clone |
Synonyms | selW; Sep; Sepw1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200204 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGCTCGCCGTTCGAGTCGTGTATTGTGGAGCTTGAGGCTATAAGCCCAAGTACCTCCAGCTCAAGG AGAAGCTAGAACATGAGTTCCCCGGATGCCTGGACATTTGTGGCGAGGGGACTCCCCAGGTCACCGGGTT CTTTGAAGTGACAGTAGCCGGGAAGTTGGTCCACTCCAAGAAGAGAGGTGATGGCTATGTGGATACAGAG AGCAAGTTCCGGAAACTGGTGACCGCCATCAAAGCTGCCTTGGCTCAGTGCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200204 protein sequence
Red=Cloning site Green=Tags(s) MALAVRVVYCGA*GYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTE SKFRKLVTAIKAALAQCQ myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_009156 |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins. |
OTI Annotation | This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_009156.2, NP_033182.1 |
RefSeq Size | 722 bp |
RefSeq ORF | 267 bp |
Locus ID | 20364 |
UniProt ID | P63300 |
Gene Summary | This gene encodes a selenoprotein containing a selenocysteine (Sec) residue, which is encoded by the UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein is highly expressed in skeletal muscle and brain. It belongs to the SelWTH family, which possesses a thioredoxin-like fold and a conserved CxxU (C is cysteine, U is Sec) motif, and has been shown to function as a glutathione-dependent antioxidant in vivo. Studies in mouse suggest that this selenoprotein is involved in muscle growth and differentiation, and in the protection of neurons from oxidative stress during neuronal development. [provided by RefSeq, Apr 2017] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC202669 | Sepw1 (untagged) - Mouse selenoprotein W, muscle 1 (Sepw1), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
CNY 1,936.00 |
|
MG200204 | Sepw1 (GFP-tagged) - Mouse selenoprotein W, muscle 1 (Sepw1), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
CNY 2,850.00 |
其它Selenow产品