Ccr6 (NM_001190335) Mouse Tagged ORF Clone

CAT#: MG227493

  • TrueORF®

Ccr6 (tGFP-tagged) - Mouse chemokine (C-C motif) receptor 6 (Ccr6) transcript variant 4, (10ug)

ORF Plasmid: DDK tGFP



  "NM_001190335" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,140.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


CCR6 Antibody - middle region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms CC-CKR-6; CCR-6; Cmkbr6; KY411
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG227493 representing NM_001190335
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATTCCACAGAGTCCTACTTTGGAACGGATGATTATGACAACACAGAGTATTATTCTATTCCTCCAG
ACCATGGGCCATGCTCCCTAGAAGAGGTCAGAAACTTCACCAAGGTATTTGTGCCAATTGCCTACTCCTT
AATATGTGTCTTTGGCCTCCTGGGCAACATTATGGTGGTGATGACCTTTGCCTTCTACAAGAAAGCCAGA
TCCATGACTGACGTCTACCTGTTGAACATGGCCATCACAGACATACTCTTTGTCCTCACCCTACCGTTCT
GGGCAGTTACTCATGCCACCAACACTTGGGTTTTCAGCGATGCACTGTGTAAACTGATGAAAGGCACATA
TGCGGTCAACTTTAACTGTGGGATGCTGCTCCTGGCCTGTATCAGCATGGACCGGTACATTGCCATCGTC
CAGGCAACCAAATCTTTCCGGGTACGCTCCAGAACACTGACGCACAGTAAGGTCATCTGTGTGGCAGTGT
GGTTCATCTCCATCATCATCTCAAGCCCTACATTTATCTTCAACAAGAAATACGAGCTGCAGGATCGTGA
TGTCTGTGAGCCACGGTACAGGTCTGTCTCAGAGCCCATCACGTGGAAGCTGCTGGGTATGGGACTGGAG
CTGTTCTTTGGGTTCTTCACCCCTTTGCTGTTTATGGTGTTCTGCTATCTGTTCATTATCAAGACCTTGG
TGCAGGCCCAGAACTCCAAGAGGCACAGAGCCATCCGAGTCGTGATCGCTGTGGTTCTCGTGTTCCTGGC
TTGTCAGATCCCTCACAACATGGTCCTCCTCGTGACTGCGGTCAACACGGGCAAAGTGGGCCGGAGCTGC
AGCACCGAGAAAGTCCTCGCCTACACCAGGAACGTGGCCGAGGTCCTGGCTTTCCTGCATTGCTGCCTCA
ACCCCGTGTTGTATGCGTTTATTGGACAGAAATTCAGAAACTACTTCATGAAGATCATGAAGGATGTGTG
GTGTATGAGAAGGAAGAATAAGATGCCTGGCTTCCTCTGTGCCCGGGTTTACTCGGAAAGCTACATCTCC
AGGCAGACCAGTGAGACCGTCGAAAATGATAATGCATCGTCCTTTACCATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG227493 representing NM_001190335
Red=Cloning site Green=Tags(s)

MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVVMTFAFYKKAR
SMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIV
QATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLE
LFFGFFTPLLFMVFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSC
STEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYIS
RQTSETVENDNASSFTM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001190335
ORF Size 1101 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001190335.1, NP_001177264.1
RefSeq Size 1348 bp
RefSeq ORF 1104 bp
Locus ID 12458
UniProt ID O54689
Gene Summary Receptor for the C-C type chemokine CCL20. Binds to CCL20 and subsequently transduces a signal by increasing the intracellular calcium ion levels (PubMed:20068036). Although CCL20 is its major ligand it can also act as a receptor for non-chemokine ligands such as beta-defensins (PubMed:25122636). Binds to defensin DEFB1 leading to increase in intracellular calcium ions and cAMP levels. Its binding to DEFB1 is essential for the function of DEFB1 in regulating sperm motility and bactericidal activity (By similarity). Binds to defensins DEFB4 and DEFB4A/B and mediates their chemotactic effects (PubMed:20068036). The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases. CCR6-mediated signals are essential for immune responses to microbes in the intestinal mucosa and in the modulation of inflammatory responses initiated by tissue insult and trauma (PubMed:21376174). CCR6 is essential for the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation (PubMed:19050256). Required for the normal migration of Th17 cells in Peyers patches and other related tissue sites of the intestine and plays a role in regulating effector T-cell balance and distribution in inflamed intestine (PubMed:19129757). Plays an important role in the coordination of early thymocyte precursor migration events important for normal subsequent thymocyte precursor development, but is not required for the formation of normal thymic natural regulatory T-cells (nTregs). Required for optimal differentiation of DN2 and DN3 thymocyte precursors (PubMed:24638065). Essential for B-cell localization in the subepithelial dome of Peyers-patches and for efficient B-cell isotype switching to IgA in the Peyers-patches (PubMed:27174992). Essential for appropriate anatomical distribution of memory B-cells in the spleen and for the secondary recall response of memory B-cells (PubMed:25505290). Positively regulates sperm motility and chemotaxis via its binding to CCL20 (PubMed:23765988).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...